Module 1, Practical 10b

In this practical we will see some other functionalities of Biopython. The content of this practical can be considered as a sort of appendix of practical 10

Biopython

From the Biopython tutorial: The Biopython Project is an international association of developers of freely available Python tools for computational molecular biology. The goal of Biopython is to make it as easy as possible to use Python for bioinformatics by creating high-quality, reusable modules and classes. Biopython features include parsers for various Bioinformatics file formats (BLAST, Clustalw, FASTA, Genbank,…), access to online services (NCBI, Expasy,…), interfaces to common and not-so-common programs (Clustalw, DSSP, MSMS…), a standard sequence class, various clustering modules, a KD tree data structure etc. and even some documentation :-).

In this practical we will see some features of Biopython but refer to biopython documentation to discover all its features, recipes etc.

These notes are largely based on the tutorial that is available here.

BLAST

Blast (Basic logical alignment search tool) is a well known tool to find similarities between biological sequences. It compares DNA or protein sequences and calculates the statistical significance of the matches found.

The typical interaction with BLAST sees the user submit some sequences to the tool to get an alignment and then the hits are parsed to obtain information on the matches. Both these steps can be performed from within Biopython. Although it is possible to interact directly with a local installation of BLAST, in this practical we will work with the tool made available by NCBI (available here). Note that this might require a lot more computational time due to the delays of the network and traffic limitations.

The function qblast

The online version of blast can be accessed through the Bio.Blast.NCBIWWW.qblast() function.

It’s basic syntax is the following (first import from Bio.Blast import NCBIWWW):

result_handle = Bio.Blast.NCBIWWW.qblast(blast_program, database, query_str)

where blast_program is the program to perform the alignment. The options are blastn, blastp, blastx, tblast or tblastx. database is the database to search against and query_str is a string containing the query to search against the database. The query can be a sequence or a fasta file entry or an identifier like a GI number (NCIBI’s sequence identification number). Among the others, some optional parameters are the output format (format_type that by default is “XML” which is the most stable output format but results can be stored also as text with “Text”). It is also possible to specify an expectation value cut-off to filter out alignments expect (the e-value threshold, default value is 10.0).

Some databases to search against are reported below:

dbs

The query string can be obtained in different ways, for example it is possible to load sequences from a fasta file with:

from Bio.Blast import NCBIWWW
fasta_string = open("myfile.fasta").read()
result_handle = NCBIWWW.qblast("blastn", "nt", fasta_string)

or we can give a SeqRecord:

from Bio.Blast import NCBIWWW
from Bio import SeqIO
record = SeqIO.read("myfile.fasta", format="fasta")
result_handle = NCBIWWW.qblast("blastn", "nt", record.seq)

It is also possible to specify some optional parameters in the entrez_query for example we can limit the search to specific organisms with: entrez_query='"Malus Domestica" [Organism]'.

Example: Let’s align the first 100 bases of the first entry of the file contigs82.fasta to the Malus Domestica genome.

NOTE: this can take several minutes.

[1]:
from Bio.Blast import NCBIWWW
from Bio import SeqIO



records = SeqIO.parse("file_samples/contigs82.fasta", format="fasta")
rec = next(records)
seq = rec.seq[0:100]
print("Aligning {} [{}] to Malus Dom.".format(rec.id,
                                              seq[0:10]+"..."+seq[90:101]))
result_handle = NCBIWWW.qblast("blastn", "nt",
                               seq,
                               entrez_query='"Malus Domestica" [Organism]'
                              )
Aligning MDC020656.85 [GAGGGGTTTA...TTGGCAGCAA] to Malus Dom.

Note that the previous code does not output anything, it just returns a result_handle. We need to parse it to get some results.

Parsing qblast output

Once the qblast call returns, it gives the results in a handle object result_handle that we can parse or we can write to disk to avoid having to rerun the query other times. If we expect to get one alignment only, we can use the method read otherwise (if we have multiple query sequences) we should use the method parse:

blast_record = NCBIXML.read(result_handle)

or

blast_records = NCBIXML.parse(result_handle)

Note that to use these methods we first need to import the NCBIXML module with from Bio.Blast import NCBIXML.

These methods are analogous to what seen in the case of SeqIO and AlignIO. In the case of multiple entries we can loop through them with:

blast_records = NCBIXML.parse(result_handle)
for record in blast_records:
    #do something with it...

or we can retrieve one record at a time with record = next(blast_records).

Saving results to file

To save the results present in the result_handle we can simply write them to file. In case we have only one entry we can read it and write it to file:

out_f = open("my_blast_result.xml", "w")
out_f.write(result_handle.read())
out_f.close
result_handle.close()

If we have more than one entry we need to loop through all the entries and save them in the file:

out_f = open("my_blast_result.xml", "w")
for entry in result_handle.parse():
    out_f.write(entry)
out_f.close
result_handle.close()

Example:

Let’s BLAST the galactosidase alpha (gi number: 2717) against the human database on NCBI and save the results to file. (Note that it can take several seconds/minutes to run!).

[2]:
from Bio.Blast import NCBIWWW

result_handle = NCBIWWW.qblast("blastn", "nt", "2717")


with open("file_samples/blast_res.xml","w") as out_f:
    out_f.write(result_handle.read())

result_handle.close()

Open a blast .XML file

A BLAST output file can be read by opening the file to get the handler and then parse it with the method parse seen above:

from Bio.Blast import NCBIXML
result_handle = open("my_blast.xml")
blast_records = NCBIXML.parse(result_handle)

This will end up in a handle to the blast results.

The BLAST record class

The Bio.Blast.Record.Blast class holds the results of the alignment. In particular it is composed of the following three information:

  1. query: the identifier of the query (a string).

  2. Descriptions : a list of Description objects. Each Description holds the following information:

    • Description.title : a string with the title of the hit;

    • Description.score : a float with the score of the alignment;

    • Description.num_alignments : an int with the number of alignments with the same subject;

    • Description.e : a float with the e-value of the alignment.

  3. Alignments : a list of Alignment objects. Each Alignment holds the following information:

    • Alignment.title : a string with the title of the hit (identical to Description.title);

    • Alignment.length : an int with the length of the alignment;

    • Alignment.hsps : a list of HSP objects (High Scoring Pair). Each HSP has the following info:

      • HSP.score : the BLAST score of the hit

      • HSP.bits : the bits score of the hit (x: on average 2^x pairs to find such a good hit by chance)

      • HSP.expect : the evalue of the hit

      • HSP.num_alignments : the number of alignments for the same subject

      • HSP.identities : the number of identities between query and subject

      • HSP.positives : the number of identical bases/aminos or having similar chemical properties

      • HSP.gaps : the number of gaps between query and subject

      • HSP.strand : a tuple with (query,subject) strands

      • HSP.frame : a tuple with the frame shifts

      • HSP.query/HSP.sbjct : query/subject sequence

      • HSP.query_start/HSP.sbjct_start :query/subject start point

      • HSP.match : the match sequence (basically “|” for matches and spaces for mismatches)

      • HSP.align_length : the alignment length.

More information on the BLAST record can be found here.

Example:

Let’s blast the serum albumin sequence (gi number 23307792) on the human genome and report all the information reported by BLAST. (warning: it might take a while to run!)

[3]:
from Bio.Blast import NCBIWWW
from Bio.Blast import NCBIXML

result_handle = NCBIWWW.qblast("blastn", "nt", "23307792",
                               entrez_query='"Homo Sapiens" [Organism]'
                               )



for res in NCBIXML.parse(result_handle):
    for d in res.descriptions:

        print("TITLE:{}\nSCORE:{}\nN.ALIGN:{}\nE-VAL:{}".format(
            d.title,d.score, d.num_alignments,d.e))

    for a in res.alignments:
        print("Align Title:{}\nAlign Len: {}".format(a.title, a.length))



        for h in a.hsps:
            s = h.score
            b = h.bits
            e = h.expect
            n = h.num_alignments
            i = h.identities
            p = h.positives
            g = h.gaps
            st = h.strand
            f = h.frame
            q = h.query
            sb = h.sbjct
            qs = h.query_start
            ss = h.sbjct_start
            qe = h.query_end
            se = h.sbjct_end
            m = h.match
            al = h.align_length

            print("Score: {} Bits: {} E-val: {}".format(s,b,e))
            print("N.aligns:{} Ident:{} Pos.:{} Gaps:{} Align len:{}".format(
                n,i,p,g,al))
            print("Strand: {} Frame: {}".format(st,f))
            print("Query:", q, " start:", qs, " end:", qe)
            print("Match:",m)
            print("Subjc:",sb, " start:", ss, " end:", se)


result_handle.close()
TITLE:gi|23307792|gb|AF542069.1| Homo sapiens serum albumin (HSA) mRNA, complete cds
SCORE:4352.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|1519245814|ref|NM_000477.7| Homo sapiens albumin (ALB), mRNA
SCORE:4305.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|28591|emb|V00495.1| H.sapiens mRNA for serum albumin
SCORE:4253.0
N.ALIGN:2
E-VAL:0.0
TITLE:gi|7770116|gb|AF119840.1|AF119840 Homo sapiens PRO0903 mRNA, complete cds
SCORE:4062.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|25058738|gb|BC039235.1| Homo sapiens albumin, mRNA (cDNA clone IMAGE:4768004), containing frame-shift errors
SCORE:4056.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|23243417|gb|BC036003.1| Homo sapiens albumin, mRNA (cDNA clone MGC:32850 IMAGE:4724105), complete cds
SCORE:4052.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|158258946|dbj|AK292755.1| Homo sapiens cDNA FLJ78413 complete cds, highly similar to Homo sapiens albumin, mRNA
SCORE:4036.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|28589|emb|V00494.1| Human messenger RNA for serum albumin (HSA)
SCORE:4033.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|21706455|gb|BC034023.1| Homo sapiens albumin, mRNA (cDNA clone MGC:22784 IMAGE:4734617), complete cds
SCORE:4029.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|51476389|emb|CR749331.1| Homo sapiens mRNA; cDNA DKFZp779N1935 (from clone DKFZp779N1935)
SCORE:4027.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|21706470|gb|BC034026.1| Homo sapiens cDNA clone IMAGE:4734794, containing frame-shift errors
SCORE:4010.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|194391079|dbj|AK298437.1| Homo sapiens cDNA FLJ54371 complete cds, highly similar to Serum albumin precursor
SCORE:3994.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|408407943|gb|AF130077.2| Homo sapiens clone FLB9714 PRO2619 mRNA, complete cds
SCORE:3937.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|62113340|gb|AY960291.1| Homo sapiens serum albumin mRNA, complete cds
SCORE:3907.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|49176516|gb|AY550967.1| Homo sapiens cell growth inhibiting protein 42 mRNA, complete cds
SCORE:3848.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|115607206|gb|DQ986150.1| Homo sapiens serum albumin mRNA, complete cds
SCORE:3733.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|164692402|dbj|AK314794.1| Homo sapiens cDNA, FLJ95666, highly similar to Homo sapiens albumin (ALB), mRNA
SCORE:3676.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|52001696|gb|AY728024.1| Homo sapiens serum albumin precursor, mRNA, complete cds
SCORE:3630.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|6013426|gb|AF190168.1|AF190168 Homo sapiens serum albumin precursor, mRNA, complete cds
SCORE:3615.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|332356379|gb|HQ537426.1| Homo sapiens albumin mRNA, partial cds
SCORE:3471.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|194391111|dbj|AK298461.1| Homo sapiens cDNA FLJ50830 complete cds, highly similar to Serum albumin precursor
SCORE:3084.0
N.ALIGN:2
E-VAL:0.0
TITLE:gi|763428|gb|U22961.1|HSU22961 Human mRNA clone with similarity to L-glycerol-3-phosphate:NAD oxidoreductase and albumin gene sequences
SCORE:2748.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|27692692|gb|BC041789.1| Homo sapiens albumin, mRNA (cDNA clone MGC:32888 IMAGE:4766983), complete cds
SCORE:2620.0
N.ALIGN:2
E-VAL:0.0
TITLE:gi|164694201|dbj|AK308044.1| Homo sapiens cDNA, FLJ97992
SCORE:2536.0
N.ALIGN:2
E-VAL:0.0
TITLE:gi|7770216|gb|AF119890.1|AF119890 Homo sapiens PRO2675 mRNA, complete cds
SCORE:2488.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|47118014|gb|AY544124.1| Homo sapiens growth-inhibiting protein 20 mRNA, complete cds
SCORE:2453.0
N.ALIGN:2
E-VAL:0.0
TITLE:gi|7959790|gb|AF116645.1|AF116645 Homo sapiens PRO1708 mRNA, complete cds
SCORE:2003.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|6650825|gb|AF118090.1|AF118090 Homo sapiens PRO2044 mRNA, complete cds
SCORE:1983.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|23241674|gb|BC035969.1| Homo sapiens albumin, mRNA (cDNA clone MGC:32581 IMAGE:4714468), complete cds
SCORE:1767.0
N.ALIGN:2
E-VAL:0.0
TITLE:gi|15679995|gb|BC014308.1|BC014308 Homo sapiens, clone IMAGE:3934797, mRNA, partial cds
SCORE:1571.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|37181745|gb|AY358313.1| Homo sapiens DNA66677 ALB (UNQ696) mRNA, partial cds
SCORE:1018.0
N.ALIGN:1
E-VAL:0.0
TITLE:gi|6642751|gb|AF113014.1|AF113014 Homo sapiens clone FLB3512 mRNA sequence
SCORE:618.0
N.ALIGN:1
E-VAL:1.28079e-155
TITLE:gi|219842221|ref|NG_009291.1| Homo sapiens albumin (ALB), RefSeqGene on chromosome 4
SCORE:581.0
N.ALIGN:15
E-VAL:2.64223e-145
TITLE:gi|152112963|gb|EF649953.1| Homo sapiens albumin (ALB) gene, complete cds
SCORE:581.0
N.ALIGN:15
E-VAL:2.64223e-145
TITLE:gi|19387810|gb|AC108157.3| Homo sapiens BAC clone RP11-580P21 from 4, complete sequence
SCORE:581.0
N.ALIGN:16
E-VAL:2.64223e-145
TITLE:gi|178343|gb|M12523.1|HUMALBGC Human serum albumin (ALB) gene, complete cds
SCORE:581.0
N.ALIGN:15
E-VAL:2.64223e-145
TITLE:gi|1036032687|gb|AH007061.2| Homo sapiens chromosome 4 serum albumin (ALB) gene, partial cds; and serum albumin-alphafetoprotein intergenic spacer, partial sequence
SCORE:579.0
N.ALIGN:1
E-VAL:9.2223e-145
TITLE:gi|408407822|gb|AF116616.2| Homo sapiens PRO0998 mRNA, complete cds
SCORE:577.0
N.ALIGN:1
E-VAL:3.2189e-144
TITLE:gi|338858118|gb|AH002596.2|SEG_HUMALB Homo sapiens albumin (ALB) gene, partial cds
SCORE:573.0
N.ALIGN:2
E-VAL:3.92142e-143
TITLE:gi|1122817323|gb|DQ145726.2| Homo sapiens ARNT-interacting protein 2 (AINP2) mRNA, complete cds
SCORE:404.0
N.ALIGN:1
E-VAL:1.56446e-97
TITLE:gi|32428|emb|X51365.1| Homo sapiens mRNA for albumin (clone pHA19)
SCORE:232.0
N.ALIGN:1
E-VAL:7.60363e-51
TITLE:gi|1338686512|ref|NG_056261.1| Homo sapiens albumin (ALB) 5' regulatory region (LOC111832671) on chromosome 4
SCORE:221.0
N.ALIGN:1
E-VAL:1.37477e-47
TITLE:gi|7959920|gb|AF116711.1|AF116711 Homo sapiens PRO2646 mRNA, complete cds
SCORE:216.0
N.ALIGN:1
E-VAL:1.67481e-46
TITLE:gi|35452|emb|X51363.1| Homo sapiens mRNA for albumin (clones pHA1, pHA12)
SCORE:208.0
N.ALIGN:1
E-VAL:2.48564e-44
TITLE:gi|35453|emb|X51364.1| Homo sapiens mRNA for albumin (clones pHA8, pHA25)
SCORE:198.0
N.ALIGN:1
E-VAL:1.28759e-41
TITLE:gi|7959874|gb|AF116688.1|AF116688 Homo sapiens PRO2133 mRNA, complete cds
SCORE:123.0
N.ALIGN:1
E-VAL:5.47982e-21
TITLE:gi|546032|gb|S69192.1| albumin {exon 8} [human, analbuminemia patient ROMA, Genomic Mutant, 60 nt]
SCORE:111.0
N.ALIGN:1
E-VAL:9.90775e-18
TITLE:gi|547231|gb|S70799.1| serum albumin=alloalbumin {Bazzano variant} [human, Genomic Mutant, 57 nt]
SCORE:102.0
N.ALIGN:1
E-VAL:1.47044e-15
TITLE:gi|1370486375|ref|XM_017007844.2| PREDICTED: Homo sapiens afamin (AFM), transcript variant X3, mRNA
SCORE:60.0
N.ALIGN:1
E-VAL:0.000369554
TITLE:gi|1370486374|ref|XM_017007843.2| PREDICTED: Homo sapiens afamin (AFM), transcript variant X2, mRNA
SCORE:60.0
N.ALIGN:1
E-VAL:0.000369554
Align Title:gi|23307792|gb|AF542069.1| Homo sapiens serum albumin (HSA) mRNA, complete cds
Align Len: 2176
Score: 4352.0 Bits: 3925.42 E-val: 0.0
N.aligns:None Ident:2176 Pos.:2176 Gaps:0 Align len:2176
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTGTGGGC  start: 1  end: 2176
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTGTGGGC  start: 1  end: 2176
Align Title:gi|1519245814|ref|NM_000477.7| Homo sapiens albumin (ALB), mRNA
Align Len: 2285
Score: 4305.0 Bits: 3883.04 E-val: 0.0
N.aligns:None Ident:2168 Pos.:2168 Gaps:1 Align len:2177
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTC-TGTGGGC  start: 1  end: 2176
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTTGTGGGC  start: 9  end: 2185
Align Title:gi|28591|emb|V00495.1| H.sapiens mRNA for serum albumin
Align Len: 2251
Score: 4253.0 Bits: 3836.15 E-val: 0.0
N.aligns:None Ident:2159 Pos.:2159 Gaps:4 Align len:2177
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATC-ACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTGTGGGC  start: 1  end: 2176
Match: |||||||||||||||||||||  ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACGC--CTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTAGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAATGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTGGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAGGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAACTGTGAGCTTTTTAAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACAAAATGCTGCACAGAGTCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCTACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTG-TTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTGTGGGC  start: 45  end: 2218
Score: 103.0 Bits: 94.1598 E-val: 1.47044e-15
N.aligns:None Ident:56 Pos.:56 Gaps:2 Align len:58
Strand: ('Plus', 'Minus') Frame: (1, -1)
Query: TGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCT  start: 489  end: 546
Match: |||||  |||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TGACA--GAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCT  start: 56  end: 1
Align Title:gi|7770116|gb|AF119840.1|AF119840 Homo sapiens PRO0903 mRNA, complete cds
Align Len: 2720
Score: 4062.0 Bits: 3663.93 E-val: 0.0
N.aligns:None Ident:2043 Pos.:2043 Gaps:0 Align len:2051
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1  end: 2051
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 649  end: 2699
Align Title:gi|25058738|gb|BC039235.1| Homo sapiens albumin, mRNA (cDNA clone IMAGE:4768004), containing frame-shift errors
Align Len: 2085
Score: 4056.0 Bits: 3658.52 E-val: 0.0
N.aligns:None Ident:2042 Pos.:2042 Gaps:1 Align len:2050
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGT-AAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 1  end: 2049
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 7  end: 2056
Align Title:gi|23243417|gb|BC036003.1| Homo sapiens albumin, mRNA (cDNA clone MGC:32850 IMAGE:4724105), complete cds
Align Len: 2087
Score: 4052.0 Bits: 3654.91 E-val: 0.0
N.aligns:None Ident:2041 Pos.:2041 Gaps:0 Align len:2051
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1  end: 2051
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGTCCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCGAA  start: 9  end: 2059
Align Title:gi|158258946|dbj|AK292755.1| Homo sapiens cDNA FLJ78413 complete cds, highly similar to Homo sapiens albumin, mRNA
Align Len: 2054
Score: 4036.0 Bits: 3640.48 E-val: 0.0
N.aligns:None Ident:2037 Pos.:2037 Gaps:3 Align len:2049
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 1  end: 2049
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||   |||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAA---AATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTTGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 9  end: 2054
Align Title:gi|28589|emb|V00494.1| Human messenger RNA for serum albumin (HSA)
Align Len: 2055
Score: 4033.0 Bits: 3637.78 E-val: 0.0
N.aligns:None Ident:2036 Pos.:2036 Gaps:0 Align len:2049
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 1  end: 2049
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGGGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCTTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTGTTAGTTCGTTACACCAAGAAAGTACCCGAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCTGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 7  end: 2055
Align Title:gi|21706455|gb|BC034023.1| Homo sapiens albumin, mRNA (cDNA clone MGC:22784 IMAGE:4734617), complete cds
Align Len: 2068
Score: 4029.0 Bits: 3634.17 E-val: 0.0
N.aligns:None Ident:2028 Pos.:2028 Gaps:0 Align len:2037
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAA  start: 1  end: 2037
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACGTTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAACAAAAAA  start: 9  end: 2045
Align Title:gi|51476389|emb|CR749331.1| Homo sapiens mRNA; cDNA DKFZp779N1935 (from clone DKFZp779N1935)
Align Len: 2075
Score: 4027.0 Bits: 3632.37 E-val: 0.0
N.aligns:None Ident:2036 Pos.:2036 Gaps:0 Align len:2051
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1  end: 2051
Match: ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCATACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCCTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGCGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAGAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAGCTGCACTTGTTGAGCTTGTGAAACACAGGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATTACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCCAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 8  end: 2058
Align Title:gi|21706470|gb|BC034026.1| Homo sapiens cDNA clone IMAGE:4734794, containing frame-shift errors
Align Len: 2059
Score: 4010.0 Bits: 3617.04 E-val: 0.0
N.aligns:None Ident:2025 Pos.:2025 Gaps:1 Align len:2037
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAA  start: 1  end: 2037
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  || ||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAA-TTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCTTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAAAAAAAAAAAAA  start: 7  end: 2042
Align Title:gi|194391079|dbj|AK298437.1| Homo sapiens cDNA FLJ54371 complete cds, highly similar to Serum albumin precursor
Align Len: 2082
Score: 3994.0 Bits: 3602.61 E-val: 0.0
N.aligns:None Ident:2040 Pos.:2040 Gaps:27 Align len:2076
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCAC---------------------------ACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 1  end: 2049
Match: ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||                           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACTATTTATTTTTTTCTTCCCTTGCCCAGACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGGAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGGATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 7  end: 2082
Align Title:gi|408407943|gb|AF130077.2| Homo sapiens clone FLB9714 PRO2619 mRNA, complete cds
Align Len: 2560
Score: 3937.0 Bits: 3551.22 E-val: 0.0
N.aligns:None Ident:1982 Pos.:1982 Gaps:0 Align len:1991
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 61  end: 2051
Match: || || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CTGTTACTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCACGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 477  end: 2467
Align Title:gi|62113340|gb|AY960291.1| Homo sapiens serum albumin mRNA, complete cds
Align Len: 1981
Score: 3907.0 Bits: 3524.17 E-val: 0.0
N.aligns:None Ident:1970 Pos.:1970 Gaps:0 Align len:1981
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAA  start: 2  end: 1982
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGGGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGGAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTGTCTATCCGTGTTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACGGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAA  start: 1  end: 1981
Align Title:gi|49176516|gb|AY550967.1| Homo sapiens cell growth inhibiting protein 42 mRNA, complete cds
Align Len: 1939
Score: 3848.0 Bits: 3470.97 E-val: 0.0
N.aligns:None Ident:1933 Pos.:1933 Gaps:0 Align len:1939
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCA  start: 27  end: 1965
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCA  start: 1  end: 1939
Align Title:gi|115607206|gb|DQ986150.1| Homo sapiens serum albumin mRNA, complete cds
Align Len: 1884
Score: 3733.0 Bits: 3367.27 E-val: 0.0
N.aligns:None Ident:1877 Pos.:1877 Gaps:0 Align len:1884
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGA  start: 23  end: 1906
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGA  start: 1  end: 1884
Align Title:gi|164692402|dbj|AK314794.1| Homo sapiens cDNA, FLJ95666, highly similar to Homo sapiens albumin (ALB), mRNA
Align Len: 1871
Score: 3676.0 Bits: 3315.88 E-val: 0.0
N.aligns:None Ident:1853 Pos.:1853 Gaps:0 Align len:1863
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAA  start: 1  end: 1863
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCCTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTTTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAATAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAA  start: 9  end: 1871
Align Title:gi|52001696|gb|AY728024.1| Homo sapiens serum albumin precursor, mRNA, complete cds
Align Len: 1842
Score: 3630.0 Bits: 3274.4 E-val: 0.0
N.aligns:None Ident:1824 Pos.:1824 Gaps:0 Align len:1830
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAA  start: 34  end: 1863
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||
Subjc: ATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAA  start: 7  end: 1836
Align Title:gi|6013426|gb|AF190168.1|AF190168 Homo sapiens serum albumin precursor, mRNA, complete cds
Align Len: 1830
Score: 3615.0 Bits: 3260.88 E-val: 0.0
N.aligns:None Ident:1821 Pos.:1821 Gaps:0 Align len:1830
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAA  start: 34  end: 1863
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||
Subjc: ATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGTAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACCTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGGAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAA  start: 1  end: 1830
Align Title:gi|332356379|gb|HQ537426.1| Homo sapiens albumin mRNA, partial cds
Align Len: 1758
Score: 3471.0 Bits: 3131.03 E-val: 0.0
N.aligns:None Ident:1749 Pos.:1749 Gaps:0 Align len:1758
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAA  start: 106  end: 1863
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||
Subjc: GATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCGTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGGGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAGAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAA  start: 1  end: 1758
Align Title:gi|194391111|dbj|AK298461.1| Homo sapiens cDNA FLJ50830 complete cds, highly similar to Serum albumin precursor
Align Len: 1799
Score: 3084.0 Bits: 2782.08 E-val: 0.0
N.aligns:None Ident:1551 Pos.:1551 Gaps:0 Align len:1557
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 493  end: 2049
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGGGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 243  end: 1799
Score: 472.0 Bits: 426.881 E-val: 5.45568e-116
N.aligns:None Ident:239 Pos.:239 Gaps:0 Align len:241
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAG  start: 1  end: 241
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAG  start: 9  end: 249
Align Title:gi|763428|gb|U22961.1|HSU22961 Human mRNA clone with similarity to L-glycerol-3-phosphate:NAD oxidoreductase and albumin gene sequences
Align Len: 3239
Score: 2748.0 Bits: 2479.12 E-val: 0.0
N.aligns:None Ident:1386 Pos.:1386 Gaps:0 Align len:1394
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAA  start: 7  end: 1400
Match: ||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGGGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCTTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAA  start: 1846  end: 3239
Align Title:gi|27692692|gb|BC041789.1| Homo sapiens albumin, mRNA (cDNA clone MGC:32888 IMAGE:4766983), complete cds
Align Len: 1510
Score: 2620.0 Bits: 2363.7 E-val: 0.0
N.aligns:None Ident:1327 Pos.:1327 Gaps:1 Align len:1337
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AAAAATTTGG-AGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 716  end: 2051
Match: ||| |||||| ||||  |  |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||
Subjc: AAAGATTTGGGAGAAGAAAATTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCGGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCGAA  start: 147  end: 1483
Score: 329.0 Bits: 297.94 E-val: 6.65812e-77
N.aligns:None Ident:166 Pos.:166 Gaps:0 Align len:167
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGC  start: 1  end: 167
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGC  start: 9  end: 175
Align Title:gi|164694201|dbj|AK308044.1| Homo sapiens cDNA, FLJ97992
Align Len: 1544
Score: 2536.0 Bits: 2287.96 E-val: 0.0
N.aligns:None Ident:1279 Pos.:1279 Gaps:1 Align len:1285
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACC-AAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAA  start: 378  end: 1661
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTTCCCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAA  start: 260  end: 1544
Score: 506.0 Bits: 457.539 E-val: 3.22174e-125
N.aligns:None Ident:256 Pos.:256 Gaps:0 Align len:258
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAA  start: 1  end: 258
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAA  start: 9  end: 266
Align Title:gi|7770216|gb|AF119890.1|AF119890 Homo sapiens PRO2675 mRNA, complete cds
Align Len: 1618
Score: 2488.0 Bits: 2244.68 E-val: 0.0
N.aligns:None Ident:1247 Pos.:1247 Gaps:0 Align len:1249
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 803  end: 2051
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 350  end: 1598
Align Title:gi|47118014|gb|AY544124.1| Homo sapiens growth-inhibiting protein 20 mRNA, complete cds
Align Len: 1363
Score: 2453.0 Bits: 2213.12 E-val: 0.0
N.aligns:None Ident:1242 Pos.:1242 Gaps:1 Align len:1251
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AAAAATTTGG-AGAAAGAGCTTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCA  start: 716  end: 1965
Match: ||| |||||| ||||  |  |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AAAGATTTGGGAGAAGAAAATTTCAAAGCATGGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCGGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCA  start: 113  end: 1363
Score: 282.0 Bits: 255.561 E-val: 2.03854e-64
N.aligns:None Ident:141 Pos.:141 Gaps:0 Align len:141
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGC  start: 27  end: 167
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGC  start: 1  end: 141
Align Title:gi|7959790|gb|AF116645.1|AF116645 Homo sapiens PRO1708 mRNA, complete cds
Align Len: 1251
Score: 2003.0 Bits: 1807.36 E-val: 0.0
N.aligns:None Ident:1006 Pos.:1006 Gaps:0 Align len:1009
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAA  start: 1029  end: 2037
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGCGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAA  start: 234  end: 1242
Align Title:gi|6650825|gb|AF118090.1|AF118090 Homo sapiens PRO2044 mRNA, complete cds
Align Len: 1759
Score: 1983.0 Bits: 1789.33 E-val: 0.0
N.aligns:None Ident:996 Pos.:996 Gaps:0 Align len:999
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1053  end: 2051
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 692  end: 1690
Align Title:gi|23241674|gb|BC035969.1| Homo sapiens albumin, mRNA (cDNA clone MGC:32581 IMAGE:4714468), complete cds
Align Len: 1449
Score: 1767.0 Bits: 1594.56 E-val: 0.0
N.aligns:None Ident:888 Pos.:888 Gaps:0 Align len:891
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1161  end: 2051
Match: |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: ATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTGTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 530  end: 1420
Score: 1048.0 Bits: 946.252 E-val: 0.0
N.aligns:None Ident:527 Pos.:527 Gaps:0 Align len:529
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAA  start: 1  end: 529
Match: ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAA  start: 9  end: 537
Align Title:gi|15679995|gb|BC014308.1|BC014308 Homo sapiens, clone IMAGE:3934797, mRNA, partial cds
Align Len: 823
Score: 1571.0 Bits: 1417.83 E-val: 0.0
N.aligns:None Ident:790 Pos.:790 Gaps:0 Align len:793
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1259  end: 2051
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||
Subjc: AGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAACTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCCAA  start: 4  end: 796
Align Title:gi|37181745|gb|AY358313.1| Homo sapiens DNA66677 ALB (UNQ696) mRNA, partial cds
Align Len: 524
Score: 1018.0 Bits: 919.201 E-val: 0.0
N.aligns:None Ident:517 Pos.:517 Gaps:0 Align len:523
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTAGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCC  start: 12  end: 534
Match: |||||||   || || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AACCCCANANGCTTTGGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTTGGTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTTCATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATACTTATATGAAATTGCC  start: 2  end: 524
Align Title:gi|6642751|gb|AF113014.1|AF113014 Homo sapiens clone FLB3512 mRNA sequence
Align Len: 1476
Score: 618.0 Bits: 558.527 E-val: 1.28079e-155
N.aligns:None Ident:312 Pos.:312 Gaps:0 Align len:314
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1738  end: 2051
Match: ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AAAGCTGCTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1153  end: 1466
Align Title:gi|219842221|ref|NG_009291.1| Homo sapiens albumin (ALB), RefSeqGene on chromosome 4
Align Len: 24158
Score: 581.0 Bits: 525.165 E-val: 2.64223e-145
N.aligns:None Ident:294 Pos.:294 Gaps:1 Align len:295
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTC-TGTGGGC  start: 1883  end: 2176
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||
Subjc: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTTGTGGGC  start: 21834  end: 22128
Score: 449.0 Bits: 406.143 E-val: 1.78347e-109
N.aligns:None Ident:226 Pos.:226 Gaps:0 Align len:227
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAAC  start: 1459  end: 1685
Match: || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TAGCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAAC  start: 18831  end: 19057
Score: 436.0 Bits: 394.421 E-val: 3.22459e-106
N.aligns:None Ident:218 Pos.:218 Gaps:0 Align len:218
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGT  start: 876  end: 1093
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGT  start: 14165  end: 14382
Score: 425.0 Bits: 384.502 E-val: 5.83019e-103
N.aligns:None Ident:214 Pos.:214 Gaps:0 Align len:215
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATA  start: 304  end: 518
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||
Subjc: CATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAGTA  start: 9340  end: 9554
Score: 278.0 Bits: 251.955 E-val: 2.48344e-63
N.aligns:None Ident:139 Pos.:139 Gaps:0 Align len:139
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTAT  start: 1323  end: 1461
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTAT  start: 18277  end: 18415
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:132
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTT  start: 172  end: 303
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTT  start: 7376  end: 7507
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:132
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGG  start: 746  end: 877
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGG  start: 12741  end: 12872
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:138 Pos.:138 Gaps:0 Align len:142
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGG  start: 1678  end: 1819
Match: ||||  | ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AAACTCAGTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGG  start: 20245  end: 20386
Score: 261.0 Bits: 236.626 E-val: 1.90927e-58
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:133
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTG  start: 1092  end: 1224
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTG  start: 15781  end: 15913
Score: 256.0 Bits: 232.118 E-val: 2.32597e-57
N.aligns:None Ident:131 Pos.:131 Gaps:0 Align len:133
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAG  start: 516  end: 648
Match: |||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||
Subjc: ATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAG  start: 10101  end: 10233
Score: 221.0 Bits: 200.559 E-val: 1.37477e-47
N.aligns:None Ident:115 Pos.:115 Gaps:0 Align len:118
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGA  start: 1  end: 118
Match: ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  ||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACGTAAGA  start: 5041  end: 5158
Score: 200.0 Bits: 181.623 E-val: 3.68902e-42
N.aligns:None Ident:100 Pos.:100 Gaps:0 Align len:100
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCG  start: 1224  end: 1323
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCG  start: 17001  end: 17100
Score: 197.0 Bits: 178.918 E-val: 4.49414e-41
N.aligns:None Ident:100 Pos.:100 Gaps:0 Align len:101
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGG  start: 647  end: 747
Match: ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGG  start: 11056  end: 11156
Score: 135.0 Bits: 123.014 E-val: 3.0308e-24
N.aligns:None Ident:69 Pos.:69 Gaps:0 Align len:70
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAG  start: 1817  end: 1886
Match: ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||
Subjc: AGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAG  start: 20998  end: 21067
Score: 117.0 Bits: 106.783 E-val: 2.33008e-19
N.aligns:None Ident:60 Pos.:60 Gaps:0 Align len:61
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTT  start: 110  end: 170
Match: || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CAGACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTT  start: 5859  end: 5919
Align Title:gi|152112963|gb|EF649953.1| Homo sapiens albumin (ALB) gene, complete cds
Align Len: 21070
Score: 581.0 Bits: 525.165 E-val: 2.64223e-145
N.aligns:None Ident:294 Pos.:294 Gaps:1 Align len:295
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTC-TGTGGGC  start: 1883  end: 2176
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||
Subjc: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTTGTGGGC  start: 18784  end: 19078
Score: 449.0 Bits: 406.143 E-val: 1.78347e-109
N.aligns:None Ident:226 Pos.:226 Gaps:0 Align len:227
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAAC  start: 1459  end: 1685
Match: || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TAGCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAAC  start: 15781  end: 16007
Score: 436.0 Bits: 394.421 E-val: 3.22459e-106
N.aligns:None Ident:218 Pos.:218 Gaps:0 Align len:218
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGT  start: 876  end: 1093
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGT  start: 11115  end: 11332
Score: 425.0 Bits: 384.502 E-val: 5.83019e-103
N.aligns:None Ident:214 Pos.:214 Gaps:0 Align len:215
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATA  start: 304  end: 518
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||
Subjc: CATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAGTA  start: 6290  end: 6504
Score: 278.0 Bits: 251.955 E-val: 2.48344e-63
N.aligns:None Ident:139 Pos.:139 Gaps:0 Align len:139
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTAT  start: 1323  end: 1461
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTAT  start: 15227  end: 15365
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:132
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTT  start: 172  end: 303
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTT  start: 4326  end: 4457
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:132
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGG  start: 746  end: 877
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGG  start: 9691  end: 9822
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:138 Pos.:138 Gaps:0 Align len:142
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGG  start: 1678  end: 1819
Match: ||||  | ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AAACTCAGTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGG  start: 17195  end: 17336
Score: 261.0 Bits: 236.626 E-val: 1.90927e-58
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:133
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTG  start: 1092  end: 1224
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTG  start: 12731  end: 12863
Score: 256.0 Bits: 232.118 E-val: 2.32597e-57
N.aligns:None Ident:131 Pos.:131 Gaps:0 Align len:133
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAG  start: 516  end: 648
Match: |||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||
Subjc: ATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAG  start: 7051  end: 7183
Score: 221.0 Bits: 200.559 E-val: 1.37477e-47
N.aligns:None Ident:115 Pos.:115 Gaps:0 Align len:118
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGA  start: 1  end: 118
Match: ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  ||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACGTAAGA  start: 1991  end: 2108
Score: 200.0 Bits: 181.623 E-val: 3.68902e-42
N.aligns:None Ident:100 Pos.:100 Gaps:0 Align len:100
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCG  start: 1224  end: 1323
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCG  start: 13951  end: 14050
Score: 197.0 Bits: 178.918 E-val: 4.49414e-41
N.aligns:None Ident:100 Pos.:100 Gaps:0 Align len:101
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGG  start: 647  end: 747
Match: ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGG  start: 8006  end: 8106
Score: 135.0 Bits: 123.014 E-val: 3.0308e-24
N.aligns:None Ident:69 Pos.:69 Gaps:0 Align len:70
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAG  start: 1817  end: 1886
Match: ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||
Subjc: AGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAG  start: 17948  end: 18017
Score: 117.0 Bits: 106.783 E-val: 2.33008e-19
N.aligns:None Ident:60 Pos.:60 Gaps:0 Align len:61
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTT  start: 110  end: 170
Match: || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CAGACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTT  start: 2809  end: 2869
Align Title:gi|19387810|gb|AC108157.3| Homo sapiens BAC clone RP11-580P21 from 4, complete sequence
Align Len: 167001
Score: 581.0 Bits: 525.165 E-val: 2.64223e-145
N.aligns:None Ident:294 Pos.:294 Gaps:1 Align len:295
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTC-TGTGGGC  start: 1883  end: 2176
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||
Subjc: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTTGTGGGC  start: 86936  end: 87230
Score: 449.0 Bits: 406.143 E-val: 1.78347e-109
N.aligns:None Ident:226 Pos.:226 Gaps:0 Align len:227
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAAC  start: 1459  end: 1685
Match: || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TAGCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAAC  start: 83933  end: 84159
Score: 436.0 Bits: 394.421 E-val: 3.22459e-106
N.aligns:None Ident:218 Pos.:218 Gaps:0 Align len:218
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGT  start: 876  end: 1093
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGT  start: 79267  end: 79484
Score: 425.0 Bits: 384.502 E-val: 5.83019e-103
N.aligns:None Ident:214 Pos.:214 Gaps:0 Align len:215
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATA  start: 304  end: 518
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||
Subjc: CATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAGTA  start: 74442  end: 74656
Score: 278.0 Bits: 251.955 E-val: 2.48344e-63
N.aligns:None Ident:139 Pos.:139 Gaps:0 Align len:139
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTAT  start: 1323  end: 1461
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTAT  start: 83379  end: 83517
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:132
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTT  start: 172  end: 303
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTT  start: 72478  end: 72609
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:132
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGG  start: 746  end: 877
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGG  start: 77843  end: 77974
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:138 Pos.:138 Gaps:0 Align len:142
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGG  start: 1678  end: 1819
Match: ||||  | ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AAACTCAGTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGG  start: 85347  end: 85488
Score: 261.0 Bits: 236.626 E-val: 1.90927e-58
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:133
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTG  start: 1092  end: 1224
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTG  start: 80883  end: 81015
Score: 256.0 Bits: 232.118 E-val: 2.32597e-57
N.aligns:None Ident:131 Pos.:131 Gaps:0 Align len:133
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAG  start: 516  end: 648
Match: |||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||
Subjc: ATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAG  start: 75203  end: 75335
Score: 221.0 Bits: 200.559 E-val: 1.37477e-47
N.aligns:None Ident:115 Pos.:115 Gaps:0 Align len:118
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGA  start: 1  end: 118
Match: ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  ||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACGTAAGA  start: 70143  end: 70260
Score: 200.0 Bits: 181.623 E-val: 3.68902e-42
N.aligns:None Ident:100 Pos.:100 Gaps:0 Align len:100
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCG  start: 1224  end: 1323
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCG  start: 82103  end: 82202
Score: 197.0 Bits: 178.918 E-val: 4.49414e-41
N.aligns:None Ident:100 Pos.:100 Gaps:0 Align len:101
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGG  start: 647  end: 747
Match: ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGG  start: 76158  end: 76258
Score: 135.0 Bits: 123.014 E-val: 3.0308e-24
N.aligns:None Ident:69 Pos.:69 Gaps:0 Align len:70
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAG  start: 1817  end: 1886
Match: ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||
Subjc: AGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAG  start: 86100  end: 86169
Score: 117.0 Bits: 106.783 E-val: 2.33008e-19
N.aligns:None Ident:60 Pos.:60 Gaps:0 Align len:61
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTT  start: 110  end: 170
Match: || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CAGACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTT  start: 70961  end: 71021
Score: 60.0 Bits: 55.3874 E-val: 0.000369554
N.aligns:None Ident:45 Pos.:45 Gaps:0 Align len:55
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAA  start: 893  end: 947
Match: |||| |||  ||| |||||||| |||||||| ||| | || || |||||||||||
Subjc: ATATTTGTTCAAAACAAGATTCTATCTCCAGCAAAATCAAAGAGTGCTGTGAAAA  start: 157736  end: 157790
Align Title:gi|178343|gb|M12523.1|HUMALBGC Human serum albumin (ALB) gene, complete cds
Align Len: 19002
Score: 581.0 Bits: 525.165 E-val: 2.64223e-145
N.aligns:None Ident:294 Pos.:294 Gaps:1 Align len:295
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTC-TGTGGGC  start: 1883  end: 2176
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||
Subjc: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTTGTGGGC  start: 18522  end: 18816
Score: 449.0 Bits: 406.143 E-val: 1.78347e-109
N.aligns:None Ident:226 Pos.:226 Gaps:0 Align len:227
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TATCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAAC  start: 1459  end: 1685
Match: || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TAGCTATCCGTGGTCCTGAACCAGTTATGTGTGTTGCATGAGAAAACGCCAGTAAGTGACAGAGTCACCAAATGCTGCACAGAATCCTTGGTGAACAGGCGACCATGCTTTTCAGCTCTGGAAGTCGATGAAACATACGTTCCCAAAGAGTTTAATGCTGAAACATTCACCTTCCATGCAGATATATGCACACTTTCTGAGAAGGAGAGACAAATCAAGAAACAAAC  start: 15531  end: 15757
Score: 436.0 Bits: 394.421 E-val: 3.22459e-106
N.aligns:None Ident:218 Pos.:218 Gaps:0 Align len:218
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGT  start: 876  end: 1093
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGCGGACCTTGCCAAGTATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAAACCTCTGTTGGAAAAATCCCACTGCATTGCCGAAGTGGAAAATGATGAGATGCCTGCTGACTTGCCTTCATTAGCTGCTGATTTTGTTGAAAGTAAGGATGTTTGCAAAAACTATGCTGAGGCAAAGGATGTCTTCCTGGGCATGT  start: 10866  end: 11083
Score: 425.0 Bits: 384.502 E-val: 5.83019e-103
N.aligns:None Ident:214 Pos.:214 Gaps:0 Align len:215
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAATA  start: 304  end: 518
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||
Subjc: CATACCCTTTTTGGAGACAAATTATGCACAGTTGCAACTCTTCGTGAAACCTATGGTGAAATGGCTGACTGCTGTGCAAAACAAGAACCTGAGAGAAATGAATGCTTCTTGCAACACAAAGATGACAACCCAAACCTCCCCCGATTGGTGAGACCAGAGGTTGATGTGATGTGCACTGCTTTTCATGACAATGAAGAGACATTTTTGAAAAAGTA  start: 6041  end: 6255
Score: 278.0 Bits: 251.955 E-val: 2.48344e-63
N.aligns:None Ident:139 Pos.:139 Gaps:0 Align len:139
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTAT  start: 1323  end: 1461
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GCTATTAGTTCGTTACACCAAGAAAGTACCCCAAGTGTCAACTCCAACTCTTGTAGAGGTCTCAAGAAACCTAGGAAAAGTGGGCAGCAAATGTTGTAAACATCCTGAAGCAAAAAGAATGCCCTGTGCAGAAGACTAT  start: 14977  end: 15115
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:132
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTT  start: 172  end: 303
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTGTTGATTGCCTTTGCTCAGTATCTTCAGCAGTGTCCATTTGAAGATCATGTAAAATTAGTGAATGAAGTAACTGAATTTGCAAAAACATGTGTTGCTGATGAGTCAGCTGAAAATTGTGACAAATCACTT  start: 4077  end: 4208
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:132
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGG  start: 746  end: 877
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGGCAGTAGCTCGCCTGAGCCAGAGATTTCCCAAAGCTGAGTTTGCAGAAGTTTCCAAGTTAGTGACAGATCTTACCAAAGTCCACACGGAATGCTGCCATGGAGATCTGCTTGAATGTGCTGATGACAGGG  start: 9443  end: 9574
Score: 264.0 Bits: 239.331 E-val: 1.56722e-59
N.aligns:None Ident:138 Pos.:138 Gaps:0 Align len:142
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AAACAAACTGCACTTGTTGAGCTTGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGG  start: 1678  end: 1819
Match: ||||  | ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AAACTCAGTGCACTTGTTGAGCTCGTGAAACACAAGCCCAAGGCAACAAAAGAGCAACTGAAAGCTGTTATGGATGATTTCGCAGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGG  start: 16933  end: 17074
Score: 261.0 Bits: 236.626 E-val: 1.90927e-58
N.aligns:None Ident:132 Pos.:132 Gaps:0 Align len:133
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATAAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTG  start: 1092  end: 1224
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTTTTTGTATGAATATGCAAGAAGGCATCCTGATTACTCTGTCGTGCTGCTGCTGAGACTTGCCAAGACATATGAAACCACTCTAGAGAAGTGCTGTGCCGCTGCAGATCCTCATGAATGCTATGCCAAAGTG  start: 12481  end: 12613
Score: 256.0 Bits: 232.118 E-val: 2.32597e-57
N.aligns:None Ident:131 Pos.:131 Gaps:0 Align len:133
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATACTTATATGAAATTGCCAGAAGACATCCTTACTTCTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAGGCTGCCTGCCTGTTGCCAAAG  start: 516  end: 648
Match: |||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||
Subjc: ATACTTATATGAAATTGCCAGAAGACATCCTTACTTTTATGCCCCGGAACTCCTTTTCTTTGCTAAAAGGTATAAAGCTGCTTTTACAGAATGTTGCCAAGCTGCTGATAAAGCTGCCTGCCTGTTGCCAAAG  start: 6802  end: 6934
Score: 221.0 Bits: 200.559 E-val: 1.37477e-47
N.aligns:None Ident:115 Pos.:115 Gaps:0 Align len:118
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGA  start: 1  end: 118
Match: ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  ||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACGTAAGA  start: 1743  end: 1860
Score: 200.0 Bits: 181.623 E-val: 3.68902e-42
N.aligns:None Ident:100 Pos.:100 Gaps:0 Align len:100
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCG  start: 1224  end: 1323
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GTTCGATGAATTTAAACCTCTTGTGGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCG  start: 13701  end: 13800
Score: 197.0 Bits: 178.918 E-val: 4.49414e-41
N.aligns:None Ident:100 Pos.:100 Gaps:0 Align len:101
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGGCTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGG  start: 647  end: 747
Match: ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AGCTCGATGAACTTCGGGATGAAGGGAAGGCTTCGTCTGCCAAACAGAGACTCAAGTGTGCCAGTCTCCAAAAATTTGGAGAAAGAGCTTTCAAAGCATGG  start: 7757  end: 7857
Score: 135.0 Bits: 123.014 E-val: 3.0308e-24
N.aligns:None Ident:69 Pos.:69 Gaps:0 Align len:70
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAG  start: 1817  end: 1886
Match: ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||
Subjc: AGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAG  start: 17686  end: 17755
Score: 117.0 Bits: 106.783 E-val: 2.33008e-19
N.aligns:None Ident:60 Pos.:60 Gaps:0 Align len:61
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CACACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTT  start: 110  end: 170
Match: || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: CAGACAAGAGTGAGGTTGCTCATCGGTTTAAAGATTTGGGAGAAGAAAATTTCAAAGCCTT  start: 2561  end: 2621
Align Title:gi|1036032687|gb|AH007061.2| Homo sapiens chromosome 4 serum albumin (ALB) gene, partial cds; and serum albumin-alphafetoprotein intergenic spacer, partial sequence
Align Len: 523
Score: 579.0 Bits: 523.362 E-val: 9.2223e-145
N.aligns:None Ident:293 Pos.:293 Gaps:1 Align len:294
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTGTGGGC  start: 1883  end: 2176
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTT-CTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTGTGGGC  start: 4  end: 296
Align Title:gi|408407822|gb|AF116616.2| Homo sapiens PRO0998 mRNA, complete cds
Align Len: 1649
Score: 577.0 Bits: 521.558 E-val: 3.2189e-144
N.aligns:None Ident:290 Pos.:290 Gaps:0 Align len:291
Strand: ('Plus', 'Minus') Frame: (1, -1)
Query: AGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1761  end: 2051
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AGCTTTTGTAGAGAAGTGCTGCAAGGCTGACGATAAGGAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 317  end: 27
Align Title:gi|338858118|gb|AH002596.2|SEG_HUMALB Homo sapiens albumin (ALB) gene, partial cds
Align Len: 1863
Score: 573.0 Bits: 517.951 E-val: 3.92142e-143
N.aligns:None Ident:290 Pos.:290 Gaps:1 Align len:291
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: CCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTC-TGTGGGC  start: 1887  end: 2176
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||
Subjc: CCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAATAGAGTGGTACAGCACTGTTATTTTTCAAAGATGTGTTGCTATCCTGAAAATTCTGTAGGTTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTTGTGGGC  start: 1387  end: 1677
Score: 221.0 Bits: 200.559 E-val: 1.37477e-47
N.aligns:None Ident:115 Pos.:115 Gaps:0 Align len:118
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGA  start: 1  end: 118
Match: ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  ||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACGTAAGA  start: 1059  end: 1176
Align Title:gi|1122817323|gb|DQ145726.2| Homo sapiens ARNT-interacting protein 2 (AINP2) mRNA, complete cds
Align Len: 1054
Score: 404.0 Bits: 365.567 E-val: 1.56446e-97
N.aligns:None Ident:205 Pos.:205 Gaps:0 Align len:207
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGCTGCCTTAGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 1845  end: 2051
Match: ||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AGCTGCCTTTGGCTTATAACATCACATTTAAAAGCATCTCAGCCTACCATGAGAATAAGAGAAAGAAAATGAAGATCAAAAGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGCCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCTAA  start: 836  end: 1042
Align Title:gi|32428|emb|X51365.1| Homo sapiens mRNA for albumin (clone pHA19)
Align Len: 117
Score: 232.0 Bits: 210.477 E-val: 7.60363e-51
N.aligns:None Ident:116 Pos.:116 Gaps:0 Align len:116
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: AGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGG  start: 1925  end: 2040
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: AGCTTATTCATCTGTTTTTCTTTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGG  start: 2  end: 117
Align Title:gi|1338686512|ref|NG_056261.1| Homo sapiens albumin (ALB) 5' regulatory region (LOC111832671) on chromosome 4
Align Len: 6858
Score: 221.0 Bits: 200.559 E-val: 1.37477e-47
N.aligns:None Ident:115 Pos.:115 Gaps:0 Align len:118
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TCTCTTCTGTCAACCCCACGCGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACACAAGA  start: 1  end: 118
Match: ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||  ||||
Subjc: TCTCTTCTGTCAACCCCACACGCCTTTGGCACAATGAAGTGGGTAACCTTTATTTCCCTTCTTTTTCTCTTTAGCTCGGCTTATTCCAGGGGTGTGTTTCGTCGAGATGCACGTAAGA  start: 6711  end: 6828
Align Title:gi|7959920|gb|AF116711.1|AF116711 Homo sapiens PRO2646 mRNA, complete cds
Align Len: 1160
Score: 216.0 Bits: 196.05 E-val: 1.67481e-46
N.aligns:None Ident:108 Pos.:108 Gaps:0 Align len:108
Strand: ('Plus', 'Minus') Frame: (1, -1)
Query: GGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCA  start: 1248  end: 1355
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: GGAAGAGCCTCAGAATTTAATCAAACAAAATTGTGAGCTTTTTGAGCAGCTTGGAGAGTACAAATTCCAGAATGCGCTATTAGTTCGTTACACCAAGAAAGTACCCCA  start: 274  end: 167
Align Title:gi|35452|emb|X51363.1| Homo sapiens mRNA for albumin (clones pHA1, pHA12)
Align Len: 104
Score: 208.0 Bits: 188.837 E-val: 2.48564e-44
N.aligns:None Ident:104 Pos.:104 Gaps:0 Align len:104
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 1946  end: 2049
Match: ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAGAATCT  start: 1  end: 104
Align Title:gi|35453|emb|X51364.1| Homo sapiens mRNA for albumin (clones pHA8, pHA25)
Align Len: 99
Score: 198.0 Bits: 179.82 E-val: 1.28759e-41
N.aligns:None Ident:99 Pos.:99 Gaps:0 Align len:99
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAG  start: 1946  end: 2044
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subjc: TTTTCGTTGGTGTAAAGCCAACACCCTGTCTAAAAAACATAAATTTCTTTAATCATTTTGCCTCTTTTCTCTGTGCTTCAATTAATAAAAAATGGAAAG  start: 1  end: 99
Align Title:gi|7959874|gb|AF116688.1|AF116688 Homo sapiens PRO2133 mRNA, complete cds
Align Len: 1247
Score: 123.0 Bits: 112.193 E-val: 5.47982e-21
N.aligns:None Ident:65 Pos.:65 Gaps:1 Align len:66
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: TTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTC-TGTGGGC  start: 2112  end: 2176
Match: |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||
Subjc: TTCTGTGGAAGTTCCAGTGTTCTCTCTTATTCCACTTCGGTAGAGGATTTCTAGTTTCTTGTGGGC  start: 1029  end: 1094
Align Title:gi|546032|gb|S69192.1| albumin {exon 8} [human, analbuminemia patient ROMA, Genomic Mutant, 60 nt]
Align Len: 60
Score: 111.0 Bits: 101.373 E-val: 9.90775e-18
N.aligns:None Ident:59 Pos.:59 Gaps:1 Align len:60
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GCGGACCTTGCCAAGTATATCTGTGAAAA-TCAAGATTCGATCTCCAGTAAACTGAAGGA  start: 877  end: 935
Match: ||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||
Subjc: GCGGACCTTGCCAAGTATATCTGTGAAAAATCAAGATTCGATCTCCAGTAAACTGAAGGA  start: 1  end: 60
Align Title:gi|547231|gb|S70799.1| serum albumin=alloalbumin {Bazzano variant} [human, Genomic Mutant, 57 nt]
Align Len: 57
Score: 102.0 Bits: 93.2581 E-val: 1.47044e-15
N.aligns:None Ident:56 Pos.:56 Gaps:1 Align len:58
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: GAGACCTGCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCGAGCTGCCTTAG  start: 1798  end: 1855
Match: |||||| ||||||||||||||||||||||||||||||||||||||| |||||||||||
Subjc: GAGACC-GCTTTGCCGAGGAGGGTAAAAAACTTGTTGCTGCAAGTCAAGCTGCCTTAG  start: 1  end: 57
Align Title:gi|1370486375|ref|XM_017007844.2| PREDICTED: Homo sapiens afamin (AFM), transcript variant X3, mRNA
Align Len: 1404
Score: 60.0 Bits: 55.3874 E-val: 0.000369554
N.aligns:None Ident:45 Pos.:45 Gaps:0 Align len:55
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAA  start: 893  end: 947
Match: |||| |||  ||| |||||||| |||||||| ||| | || || |||||||||||
Subjc: ATATTTGTTCAAAACAAGATTCTATCTCCAGCAAAATCAAAGAGTGCTGTGAAAA  start: 891  end: 945
Align Title:gi|1370486374|ref|XM_017007843.2| PREDICTED: Homo sapiens afamin (AFM), transcript variant X2, mRNA
Align Len: 1395
Score: 60.0 Bits: 55.3874 E-val: 0.000369554
N.aligns:None Ident:45 Pos.:45 Gaps:0 Align len:55
Strand: ('Plus', 'Plus') Frame: (1, 1)
Query: ATATCTGTGAAAATCAAGATTCGATCTCCAGTAAACTGAAGGAATGCTGTGAAAA  start: 893  end: 947
Match: |||| |||  ||| |||||||| |||||||| ||| | || || |||||||||||
Subjc: ATATTTGTTCAAAACAAGATTCTATCTCCAGCAAAATCAAAGAGTGCTGTGAAAA  start: 891  end: 945

Example: Let’s align the first 100 bases of the first 5 entries of the file contigs82.fasta to the Malus Domestica genome, writing the results to a apple_first5.xml file. Sample output is here: apple_first5.xml. NOTE: this can take several minutes.

[4]:
from Bio.Blast import NCBIWWW
from Bio import SeqIO

rc = SeqIO.parse("file_samples/contigs82.fasta", format="fasta")
fasta_string = ""
ids2align =[]
for i in range(5):
    entry = next(rc)
    fasta_string +=">" + entry.id +"\n"+entry.seq +"\n"
    ids2align.append(entry.id)
print("Aligning the following {} entries:\n\t{}".format(
                                                    len(ids2align),
                                                    "\n\t".join(ids2align)
                                                    ))
result_handle = NCBIWWW.qblast("blastn", "nt",
                               fasta_string,
                               entrez_query='"Malus Domestica" [Organism]'
                              )

with open("file_samples/blast_res_apple.xml","w") as out_f:
    out_f.write(result_handle.read())
print("Output written to \"blast_res_apple.xml\"")
Aligning the following 5 entries:
        MDC020656.85
        MDC001115.177
        MDC013284.379
        MDC018185.243
        MDC018185.241
Output written to "blast_res_apple.xml"

Getting data from NCBI

Biopython provides a module (Bio.Entrez) to pull data off resources like PubMed or GenBank, and other repositories programmatically through Entrez.

There are some limitations (mostly taken care of directly by Biopython) that you should be aware of when you use NCBI’s services (e.g. they recommend not to run more than 3 requests per second on weekdays, …). Check here if you want to learn what these limitations are.

First of all we need to import the Entrez module with (from Bio import Entrez) and then we can start interacting with Entrez, then we should specify (optional) an email setting Entrez.email (this is optional but you get a warning if you do not specify it – the email would be used to notify the user in case of excessive usage).

In particular the module (complete info on Entrez module are here) provides, among the others, the following functions:

  1. res_handle = Entrez.einfo(db) returns a summary of the Entez databases as a results handle. db is an optional parameter specifying the resource of interest;

  2. res_handle = Entrez.esearch(db, term,id) returns all the entries in db having query matching the term term. It is also possible to specify an id to get the information relative to that resource id;

  3. res_handle = Entrez.efetch(db, id, rettype, retmode) returns full record corresponding to the identifier id from the database db formatted in rettype (eg. gb, fasta,… complete list) and return mode retmode (eg. text);

  4. res_handle = Entrez.esummary(db, id) returns the summary of the entry id from the database db as a handle;

  5. result = Entrez.read(res_handle) reads the information on the XML handle res_handle and stores them in a dictionary, list or string, depending on the case.

Example:

Let’s get a list of all available databases in Entrez as a dictionary. Let’s then get a summary of the entries in ‘sra’.

[47]:
from Bio import Entrez
import datetime


Entrez.email = "my_email"
handle = Entrez.einfo()
res = Entrez.read(handle)
#print(res)
print("")
print("As a list:")
print(res['DbList'])

res = Entrez.read(Entrez.einfo(db = "sra"))
#uncomment to see all the information captured
#print(res)
#for el in res["DbInfo"].keys():
#    print(el)
date = res["DbInfo"]["LastUpdate"]
dt = datetime.datetime.strptime(date, "%Y/%m/%d %H:%M")
print("")
print("Entries count: {:,}".format(int(res["DbInfo"]["Count"])))
print("LastUpdate: {}/{}/{} {}:{}".format(dt.day,
                                          dt.month,
                                          dt.year,
                                          dt.hour,
                                          dt.minute))
print("Description:", res["DbInfo"]["Description"])




As a list:
['pubmed', 'protein', 'nuccore', 'ipg', 'nucleotide', 'structure', 'sparcle', 'protfam', 'genome', 'annotinfo', 'assembly', 'bioproject', 'biosample', 'blastdbinfo', 'books', 'cdd', 'clinvar', 'gap', 'gapplus', 'grasp', 'dbvar', 'gene', 'gds', 'geoprofiles', 'homologene', 'medgen', 'mesh', 'ncbisearch', 'nlmcatalog', 'omim', 'orgtrack', 'pmc', 'popset', 'proteinclusters', 'pcassay', 'biosystems', 'pccompound', 'pcsubstance', 'seqannot', 'snp', 'sra', 'taxonomy', 'biocollections', 'gtr']

Entries count: 12,222,409
LastUpdate: 27/10/2020 4:39
Description: SRA Database

Note that effectively einfo returned a handler to an object that can be read by the read function that produces a dictionary. This dictionary had one key only “DbList” that is the list of available databases in the first case, while the key when db was specified is “DbInfo”.

Example: Fetch the latest 10 entries (retmax = 10) in pubmed that are related to the species “Pyrus Communis” and report the title of the publication.

[43]:
from Bio import Entrez

Entrez.email = "my_email"
handle = Entrez.esearch(db="pubmed", term="Pyrus communis", retmax = 10)
res = Entrez.read(handle)
for el in res.keys():
    print(el , " : ", res[el])

print("")
for ids in res["IdList"]:
    print("Results for id:", ids)
    handle = Entrez.esummary(db="pubmed",  id = ids)
    res = Entrez.read(handle)
    #uncomment to see all info
    #print(res)
    for r in res:
        print(r["Title"])
        print("{}, {}".format(r['FullJournalName'],r['SO']))


        print("")

Count  :  356
RetMax  :  10
RetStart  :  0
IdList  :  ['33038244', '32992651', '32990517', '32972020', '32942590', '32899287', '32894061', '32889351', '32882874', '32849839']
TranslationSet  :  [{'From': 'Pyrus', 'To': '"pyrus"[MeSH Terms] OR "pyrus"[All Fields]'}]
TranslationStack  :  [{'Term': '"pyrus"[MeSH Terms]', 'Field': 'MeSH Terms', 'Count': '1092', 'Explode': 'Y'}, {'Term': '"pyrus"[All Fields]', 'Field': 'All Fields', 'Count': '1573', 'Explode': 'N'}, 'OR', 'GROUP', {'Term': 'communis[All Fields]', 'Field': 'All Fields', 'Count': '6139', 'Explode': 'N'}, 'AND', 'GROUP']
QueryTranslation  :  ("pyrus"[MeSH Terms] OR "pyrus"[All Fields]) AND communis[All Fields]

Results for id: 33038244
From the roots to the stem: unveiling pear root colonization and infection pathways by Erwinia amylovora.
FEMS microbiology ecology, 2020 Oct 10;

Results for id: 32992651
Bioactive Compounds and Health-Promoting Properties of Pear (<i>Pyrus communis</i> L.) Fruits.
Molecules (Basel, Switzerland), 2020 Sep 27;25(19)

Results for id: 32990517
First report of <i>Phytophthora chlamydospora</i> causing postharvest fruit rot on apples and pears in the Netherlands.
Plant disease, 2020 Sep 29;

Results for id: 32972020
Organic Control of Pear Psylla in Pear with Trunk Injection.
Insects, 2020 Sep 22;11(9)

Results for id: 32942590
The Impact of Plant-Based Coatings in "ROCHA" Pear Preservation during Cold Storage: A Metabolomic Approach.
Foods (Basel, Switzerland), 2020 Sep 15;9(9)

Results for id: 32899287
Characterization of <i>PcLEA14</i>, a Group 5 Late Embryogenesis Abundant Protein Gene from Pear (<i>Pyrus communis</i>).
Plants (Basel, Switzerland), 2020 Sep 3;9(9)

Results for id: 32894061
Genome-wide identification of lysin motif containing protein family genes in eight rosaceae species, and expression analysis in response to pathogenic fungus Botryosphaeria dothidea in Chinese white pear.
BMC genomics, 2020 Sep 7;21(1):612

Results for id: 32889351
Elucidating the involvement of ethylene and oxidative stress during on- and off-tree ripening of two pear cultivars with different ripening patterns.
Plant physiology and biochemistry : PPB, 2020 Oct;155:842-850

Results for id: 32882874
Physicochemical Fingerprint of "Pera Rocha do Oeste". A PDO Pear Native from Portugal.
Foods (Basel, Switzerland), 2020 Sep 1;9(9)

Results for id: 32849839
RIGD: A Database for Intronless Genes in the Rosaceae.
Frontiers in genetics, 2020;11:868

Example: Retrieve genbank formatted information of the Malus x domestica MYB domain class transcription factor (MYB1) mRNA complete cds (nucleotide database id:HM122614.1). Parse it as a SeqRecord, printing only the sequence (remember previous practical’s SeqIO).

[7]:
from Bio import Entrez
from Bio import SeqIO

Entrez.email = "my_email"
handle = Entrez.efetch(db="nucleotide",
                       id = "HM122614.1",
                       rettype = "gb",
                       retmode="text")
my_seq = SeqIO.read(handle, format = "genbank")
print(handle.read())
print(my_seq)
print("")
print("SEQUENCE:")
print(my_seq.seq)

ID: HM122614.1
Name: HM122614
Description: Malus x domestica MYB domain class transcription factor (MYB1) mRNA, complete cds
Number of features: 3
/molecule_type=mRNA
/topology=linear
/data_file_division=HTC
/date=15-AUG-2010
/accessions=['HM122614']
/sequence_version=1
/keywords=['HTC']
/source=Malus domestica (apple)
/organism=Malus domestica
/taxonomy=['Eukaryota', 'Viridiplantae', 'Streptophyta', 'Embryophyta', 'Tracheophyta', 'Spermatophyta', 'Magnoliopsida', 'eudicotyledons', 'Gunneridae', 'Pentapetalae', 'rosids', 'fabids', 'Rosales', 'Rosaceae', 'Amygdaloideae', 'Maleae', 'Malus']
/references=[Reference(title='Transcription Factors in Apple', ...), Reference(title='The FruiTFul database; full length cDNAs of apple transcription factors', ...), Reference(title='Direct Submission', ...)]
Seq('TTTGGTCTGCTGGGTAGGTACTCATAAAAACAAACCAACCGAAGCCTCCGAACC...AAA')

SEQUENCE:
TTTGGTCTGCTGGGTAGGTACTCATAAAAACAAACCAACCGAAGCCTCCGAACCGACCACCAATGACGGCCCCAAACGGCGCCGTCCCCAAACAAGCCGACGACCGCCCCGGCACCGAGGCCGAGTTGAACGAGGGCGCAGTGCCCAACGGGAAAGTGAGGGGACCGTGGTCGCCCGAGGAGGACGCGGTGCTGAGCCGGCTCGTGAGCAACTTCGGGGCGAGGAATTGGAGCCTGATCGCCCGAGGAATTCCCGGACGGTCTGGGAAGTCGTGCCGGCTGAGGTGGTGTAATCAGCTTGACCCCTGCGTCAAGCGTAAACCCTTTTCTGAGGAAGAAGACCGTATTATAGTTTCAGCACATGCTATCCATGGGAACAAATGGGCAGTAATTGCAAAGCTTCTTCCAGGTAGAACAGATAACGGAATCAAGAACCATTGGAATTCTACACTAAGGCGCAAGTGCTTTGATAAAGGAAGGTTTAATACTGGACCTGGGGAAATGATGGAAGATGACACCTTTGACAGAAAAAATGCATCCTCAGAAGAAACCCTGTCAGTTGGGAATATCAGTTCATTCAAGACTCATGAAGGAAGAGAGGTCTTGATGGAAAATAGACCAAACCAGTTCGATGTAAGAAGTCATGCAAAGGAGGGCTCTGGCGCTGCCGAATCAAAGCACAATTCTACTCTTATTGCCGAGCCAAGAGACCATCCGACTCTCCAGTCCACCATTTGTTGTCCAGTGGCACGTGTTAGTGCATTTAGTGTTTATAACCGTCCAAGTGTTCCAGCAAATGCTTCATCGTTGTCAAGGACAGTCCCAAGTCATGGCCCTTTGGTCCCAATAACTAAACTAGATTTCGGCTTTGACAACTTCCTTGAAGGTGCATGCAATGAGCCTACGGTTCCTCAACGCTGTGGTCACGGTTGCTGTGATCGAATTGAGGGGCATTCTCAAAGCTCGTTGTTGGGGCCTGAGTTCGTTGAGTATGATGAGCCTCTCCCTTTCTCTAGCCACGAATTAATCTCCATTGCTACGGATTTGAACAAGATTGCATGGATTAAGGGTGGCCTTGAGAGTAATGGGATAAGGATGCCAGAGCACGTAGCAAGCCAGAGAGTCTTTCAAGCAGCTGCCACTACCTTGCAAATGGGGTTGCCAGCAAACACTCCGATGAATGACCATATGCGCTTTGAGGAAGGAAGAAACAAGTTGATGGGAATGATGACGGACGTGCTATCAACCCAGGTGCCTAGACAAACTTTTGCAATGCCAACTGAAGTTGAGGGATTGAGCTAGAACTCATGGCTGGTCTTCCTCAGTCTTCCGGGTGTTTCGGTTAATTTACAGCAGATTAAGTTGAAGTCTCCAGTTTCATTTAGAAGGCTTTTCACTTTTGACTTATCTCGTTTAAGAGGGCATTACATCAAAGATATATATGTAGGTACTTCTCTACCCCTTTTGTCATGAGCAAAGAAGCTGTTGACTAGTAAATGCTTTTATACAAGTGCTTTTATCTCAAATCCGAAAACATAATTGATAAAAAAAAAAAA

Getting data from ExPASy

Similarly to what done with Entrez, it is possible to pull data out of ExPASy (https://www.expasy.org/) through the Bio.ExPASy module. We will not cover this in detail. All information can be found here: Bio.ExPASy module.

As an example, we will see how to download a couple of SwissProt entries (the human, rhesus macaque and mouse P53 protein) and perform pairwise sequence alignment of Human vs Macaque and Human vs Mouse.

[8]:
from Bio import ExPASy
from Bio import SwissProt
from Bio import pairwise2

#the ids of the human, rhesus and mouse proteins
accessions = ["P04637", "P56424", "P02340"]
sequences = []
for accession in accessions:
    handle = ExPASy.get_sprot_raw(accession)
    record = SwissProt.read(handle)
    print("Organism: {}".format(record.organism))
    print(record.entry_name)
    print(",".join(record.accessions))
    print(record.keywords)

    print(record.sequence[:30] + "...")
    sequences.append(record.sequence)

print("\n\nPairwise sequence alignment of Human vs Rhesus P53:")

aligns = pairwise2.align.globalxx(sequences[0],sequences[1])
for al in aligns[0:3]:
    print("Score {}:".format(al[2]))
    print(al[0][0:50])
    print(al[1][0:50])

print("\n\nPairwise sequence alignment of Human vs Mouse P53:")

aligns = pairwise2.align.globalxx(sequences[0],sequences[2])
for al in aligns[0:3]:
    print("Score {}:".format(al[2]))
    print(al[0][0:50])
    print(al[1][0:50])
Organism: Homo sapiens (Human).
P53_HUMAN
P04637,Q15086,Q15087,Q15088,Q16535,Q16807,Q16808,Q16809,Q16810,Q16811,Q16848,Q2XN98,Q3LRW1,Q3LRW2,Q3LRW3,Q3LRW4,Q3LRW5,Q86UG1,Q8J016,Q99659,Q9BTM4,Q9HAQ8,Q9NP68,Q9NPJ2,Q9NZD0,Q9UBI2,Q9UQ61
['3D-structure', 'Acetylation', 'Activator', 'Alternative promoter usage', 'Alternative splicing', 'Apoptosis', 'Biological rhythms', 'Cell cycle', 'Cytoplasm', 'Cytoskeleton', 'Direct protein sequencing', 'Disease mutation', 'DNA-binding', 'Endoplasmic reticulum', 'Glycoprotein', 'Host-virus interaction', 'Isopeptide bond', 'Li-Fraumeni syndrome', 'Metal-binding', 'Methylation', 'Mitochondrion', 'Necrosis', 'Nucleus', 'Phosphoprotein', 'Polymorphism', 'Reference proteome', 'Repressor', 'Transcription', 'Transcription regulation', 'Tumor suppressor', 'Ubl conjugation', 'Zinc']
MEEPQSDPSVEPPLSQETFSDLWKLLPENN...
Organism: Macaca mulatta (Rhesus macaque).
P53_MACMU
P56424
['Acetylation', 'Activator', 'Apoptosis', 'Biological rhythms', 'Cell cycle', 'Cytoplasm', 'Cytoskeleton', 'DNA-binding', 'Endoplasmic reticulum', 'Isopeptide bond', 'Metal-binding', 'Methylation', 'Mitochondrion', 'Necrosis', 'Nucleus', 'Phosphoprotein', 'Reference proteome', 'Repressor', 'Transcription', 'Transcription regulation', 'Tumor suppressor', 'Ubl conjugation', 'Zinc']
MEEPQSDPSIEPPLSQETFSDLWKLLPENN...
Organism: Mus musculus (Mouse).
P53_MOUSE
P02340,Q9QUP3
['3D-structure', 'Acetylation', 'Activator', 'Apoptosis', 'Biological rhythms', 'Cell cycle', 'Cytoplasm', 'Cytoskeleton', 'Disease mutation', 'DNA-binding', 'Endoplasmic reticulum', 'Isopeptide bond', 'Metal-binding', 'Methylation', 'Mitochondrion', 'Necrosis', 'Nucleus', 'Phosphoprotein', 'Reference proteome', 'Repressor', 'Transcription', 'Transcription regulation', 'Tumor suppressor', 'Ubl conjugation', 'Zinc']
MTAMEESQSDISLELPLSQETFSGLWKLLP...


Pairwise sequence alignment of Human vs Rhesus P53:
Score 376.0:
MEEPQSDPSV-EPPLSQETFSDLWKLLPENNVLSPLPSQAM-DDLMLSPD
MEEPQSDPS-IEPPLSQETFSDLWKLLPENNVLSPLPSQA-VDDLMLSPD
Score 376.0:
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAM-DDLMLSPDD
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQA-VDDLMLSPDD
Score 376.0:
MEEPQSDPSV-EPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDD
MEEPQSDPS-IEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDD


Pairwise sequence alignment of Human vs Mouse P53:
Score 315.0:
M---EEP-QSDP-SV-EP-PLSQETFSD-LWKLLPENNVLSP---LPSQA
MTAMEE-SQSD-IS-LE-LPLSQETFS-GLWKLLP------PEDILPS--
Score 315.0:
---MEEP-QSDP-SV-EP-PLSQETFSD-LWKLLPENNVLSP---LPSQA
MTAMEE-SQSD-IS-LE-LPLSQETFS-GLWKLLP------PEDILPS--
Score 315.0:
M---EEPQSDP-SV-EP-PLSQETFSD-LWKLLPENNVLSP---LPSQA-
MTAMEESQSD-IS-LE-LPLSQETFS-GLWKLLP------PEDILPS--P

You can find here all the details on how to deal with the SwissProt records.

3D structure and PDB

Biopython can also deal with data coming from the Protein Data Bank database. It is a database of structural information of 3D shapes of proteins, nucleic acids, and complex assemblies. The database currently contains more than 157,000 total structures.

To deal with this kind of data we first need to import Biopython’s module Bio.PDB with from Bio.PDB import *. All the information on this module can be found here.

It is possible to download a structure directly from PDB by using a PDBList object that features a function called download_pdb_files having the basic syntax:

PDBList.download_pdb_files(pdb_codes, pdir, file_format)

that downloads the file_format formatted structures defined in the pdb_codes list of 4 symbols structure Ids from PDB, stores them in the directory pdir. The safer file_format to use is “mmCif”. The function will not download the structures more than once. If a file is already present in the specified directory, a message Structure exists will be displayed.

Example:

Let’s programmatically download two different structures of the DNA polymerase 3C2K and 3C2L

[9]:
from Bio.PDB import *

pdbl = PDBList()
structures = ["3C2K", "3C2L"]
el = pdbl.download_pdb_files(structures,
                             file_format = "mmCif",
                             pdir = "file_samples/")

Downloading PDB structure '3C2K'...
Downloading PDB structure '3C2L'...

Macromolecular Crystallographic Information Files (mmCif files .cif) is a paired collection of names (starting with “_”) and values.They also contain a description of the 3D placement of every crystalized atom of the structure. A detailed description of the format can be found here.

Once the structures are available locally, one can start parsing them to do something useful. Parsing can be done through the MMCIFParser object:

parser = MMCIFParser()

The parser object has several methods able to deal with structures. One of these is the get_structure that creates a PDB.Structure.Structure object with all the data present in the structure file.

The basic syntax is:

structure = parser.get_structure(pdb_code, filename)

where pdb_code is the PDB code of the structure contained in the file filename. The method returns a PDB.Structure.Structure that contains one or more models.

A Structure consists of a collection of one or more Model (different 3D conformations of the very same structure) that is a collection of Chain that is a collection of Residues that is a collection of Atoms. Look in the documentation to get the information on each of these classes. This is the diagram of a structure:

structure

Given a Structure we can obtain iterators to models, chains, residues or atoms with:

Structure.get_models()
Structure.get_chains()
Structure.get_residues()
Structure.get_atoms()

For each model obtained with structure.get_models() function we can loop through its chains, residues and atoms. For atoms we can get the 3D coordinates with Atom.get_coord().

Example: Let’s loop through all the models, chain, residues and atoms of the DNA polymerase structure 3C2K. Print the 3D coordinates of each atom.

[10]:
from Bio.PDB import *


parser = MMCIFParser(QUIET=True) #To disable warnings


filename = "file_samples/3c2l.cif"
structure = parser.get_structure("3c2l", filename)

for model in structure.get_models():
    print("model", model, "has {} chains".format(len(model)))

    for chain in model:
        print(" - chain ", chain, "has {} residues".format(len(chain)))

        for residue in chain:
            print ("      - residue", residue.get_resname(), "has {} atoms".format(len(residue)))

            for atom in residue:
                x,y,z = atom.get_coord()
                print("        - atom:", atom.get_name(), "x: {} y:{} z:{}".format(x,y,z))
model <Model id=0> has 4 chains
 - chain  <Chain id=T> has 41 residues
      - residue DC has 16 atoms
        - atom: O5' x: 30.740999221801758 y:-2.2209999561309814 z:16.618999481201172
        - atom: C5' x: 31.167999267578125 y:-0.9599999785423279 z:16.062999725341797
        - atom: C4' x: 29.996000289916992 y:-0.009999999776482582 z:15.932999610900879
        - atom: O4' x: 28.96299934387207 y:-0.6069999933242798 z:15.107000350952148
        - atom: C3' x: 29.320999145507812 y:0.38499999046325684 z:17.253000259399414
        - atom: O3' x: 29.166000366210938 y:1.8140000104904175 z:17.327999114990234
        - atom: C2' x: 27.96500015258789 y:-0.3019999861717224 z:17.187999725341797
        - atom: C1' x: 27.701000213623047 y:-0.3490000069141388 z:15.692000389099121
        - atom: N1 x: 26.76099967956543 y:-1.4010000228881836 z:15.24899959564209
        - atom: C2 x: 25.65999984741211 y:-1.034000039100647 z:14.456999778747559
        - atom: O2 x: 25.51300048828125 y:0.16200000047683716 z:14.140999794006348
        - atom: N3 x: 24.78499984741211 y:-1.9910000562667847 z:14.057000160217285
        - atom: C4 x: 24.97599983215332 y:-3.2660000324249268 z:14.414999961853027
        - atom: N4 x: 24.086000442504883 y:-4.172999858856201 z:14.0
        - atom: C5 x: 26.08799934387207 y:-3.6679999828338623 z:15.21399974822998
        - atom: C6 x: 26.94700050354004 y:-2.7139999866485596 z:15.604000091552734
      - residue DC has 19 atoms
        - atom: P x: 28.641000747680664 y:2.5 z:18.69099998474121
        - atom: OP1 x: 29.559999465942383 y:3.625 z:19.025999069213867
        - atom: OP2 x: 28.385000228881836 y:1.4290000200271606 z:19.698999404907227
        - atom: O5' x: 27.225000381469727 y:3.124000072479248 z:18.30299949645996
        - atom: C5' x: 27.128999710083008 y:4.366000175476074 z:17.600000381469727
        - atom: C4' x: 25.67799949645996 y:4.741000175476074 z:17.399999618530273
        - atom: O4' x: 24.954999923706055 y:3.5789999961853027 z:16.92799949645996
        - atom: C3' x: 24.93600082397461 y:5.171000003814697 z:18.663000106811523
        - atom: O3' x: 23.81800079345703 y:5.980000019073486 z:18.29800033569336
        - atom: C2' x: 24.413000106811523 y:3.8489999771118164 z:19.187999725341797
        - atom: C1' x: 23.961999893188477 y:3.2190001010894775 z:17.882999420166016
        - atom: N1 x: 23.832000732421875 y:1.7519999742507935 z:17.87299919128418
        - atom: C2 x: 22.68899917602539 y:1.1799999475479126 z:17.298999786376953
        - atom: O2 x: 21.812999725341797 y:1.9190000295639038 z:16.829999923706055
        - atom: N3 x: 22.569000244140625 y:-0.16200000047683716 z:17.268999099731445
        - atom: C4 x: 23.52899932861328 y:-0.9279999732971191 z:17.78700065612793
        - atom: N4 x: 23.367000579833984 y:-2.252000093460083 z:17.738000869750977
        - atom: C5 x: 24.697999954223633 y:-0.37400001287460327 z:18.3799991607666
        - atom: C6 x: 24.808000564575195 y:0.9559999704360962 z:18.40399932861328
      - residue DG has 22 atoms
        - atom: P x: 23.493000030517578 y:7.309000015258789 z:19.131000518798828
        - atom: OP1 x: 24.016000747680664 y:8.472999572753906 z:18.36199951171875
        - atom: OP2 x: 23.934999465942383 y:7.0960001945495605 z:20.5310001373291
        - atom: O5' x: 21.90399932861328 y:7.382999897003174 z:19.136999130249023
        - atom: C5' x: 21.174999237060547 y:7.506999969482422 z:17.922000885009766
        - atom: C4' x: 19.93899917602539 y:6.644999980926514 z:17.98200035095215
        - atom: O4' x: 20.363000869750977 y:5.269000053405762 z:18.142000198364258
        - atom: C3' x: 19.0310001373291 y:6.951000213623047 z:19.179000854492188
        - atom: O3' x: 17.66200065612793 y:6.968999862670898 z:18.77199935913086
        - atom: C2' x: 19.263999938964844 y:5.7769999504089355 z:20.11400032043457
        - atom: C1' x: 19.552000045776367 y:4.665999889373779 z:19.12700080871582
        - atom: N9 x: 20.26799964904785 y:3.5169999599456787 z:19.67300033569336
        - atom: C8 x: 21.375 y:3.5269999504089355 z:20.490999221801758
        - atom: N7 x: 21.760000228881836 y:2.3299999237060547 z:20.850000381469727
        - atom: C5 x: 20.85700035095215 y:1.4789999723434448 z:20.225000381469727
        - atom: C6 x: 20.763999938964844 y:0.06800000369548798 z:20.246999740600586
        - atom: O6 x: 21.47800064086914 y:-0.7459999918937683 z:20.850000381469727
        - atom: N1 x: 19.707000732421875 y:-0.382999986410141 z:19.465999603271484
        - atom: C2 x: 18.85099983215332 y:0.4169999957084656 z:18.756000518798828
        - atom: N2 x: 17.89900016784668 y:-0.20800000429153442 z:18.055999755859375
        - atom: N3 x: 18.92099952697754 y:1.7330000400543213 z:18.733999252319336
        - atom: C4 x: 19.940000534057617 y:2.194999933242798 z:19.485000610351562
      - residue DA has 21 atoms
        - atom: P x: 16.55500030517578 y:7.6579999923706055 z:19.7189998626709
        - atom: OP1 x: 16.44099998474121 y:9.088000297546387 z:19.329999923706055
        - atom: OP2 x: 16.868000030517578 y:7.307000160217285 z:21.135000228881836
        - atom: O5' x: 15.189000129699707 y:6.940000057220459 z:19.316999435424805
        - atom: C5' x: 14.980999946594238 y:6.421999931335449 z:18.000999450683594
        - atom: C4' x: 13.972000122070312 y:5.296999931335449 z:18.041000366210938
        - atom: O4' x: 14.60099983215332 y:4.105000019073486 z:18.56999969482422
        - atom: C3' x: 12.777000427246094 y:5.566999912261963 z:18.947999954223633
        - atom: O3' x: 11.604000091552734 y:4.940000057220459 z:18.440000534057617
        - atom: C2' x: 13.196000099182129 y:4.954999923706055 z:20.273000717163086
        - atom: C1' x: 14.07699966430664 y:3.7829999923706055 z:19.85700035095215
        - atom: N9 x: 15.21399974822998 y:3.496999979019165 z:20.743000030517578
        - atom: C8 x: 15.923999786376953 y:4.367000102996826 z:21.542999267578125
        - atom: N7 x: 16.92300033569336 y:3.805999994277954 z:22.18000030517578
        - atom: C5 x: 16.867000579833984 y:2.4760000705718994 z:21.781999588012695
        - atom: C6 x: 17.660999298095703 y:1.3539999723434448 z:22.099000930786133
        - atom: N6 x: 18.72599983215332 y:1.3949999809265137 z:22.900999069213867
        - atom: N1 x: 17.31800079345703 y:0.1720000058412552 z:21.548999786376953
        - atom: C2 x: 16.260000228881836 y:0.12600000202655792 z:20.73200035095215
        - atom: N3 x: 15.449000358581543 y:1.1030000448226929 z:20.347999572753906
        - atom: C4 x: 15.809000015258789 y:2.2679998874664307 z:20.913000106811523
      - residue DC has 19 atoms
        - atom: P x: 10.178999900817871 y:5.289999961853027 z:19.089000701904297
        - atom: OP1 x: 9.128999710083008 y:5.105999946594238 z:18.054000854492188
        - atom: OP2 x: 10.288999557495117 y:6.593999862670898 z:19.79800033569336
        - atom: O5' x: 9.972999572753906 y:4.1579999923706055 z:20.18600082397461
        - atom: C5' x: 9.642000198364258 y:2.8340001106262207 z:19.795000076293945
        - atom: C4' x: 9.98900032043457 y:1.8619999885559082 z:20.893999099731445
        - atom: O4' x: 11.369999885559082 y:1.9759999513626099 z:21.277000427246094
        - atom: C3' x: 9.21500015258789 y:2.0450000762939453 z:22.19499969482422
        - atom: O3' x: 8.050999641418457 y:1.2230000495910645 z:22.155000686645508
        - atom: C2' x: 10.194000244140625 y:1.5709999799728394 z:23.26799964904785
        - atom: C1' x: 11.472000122070312 y:1.246999979019165 z:22.483999252319336
        - atom: N1 x: 12.76099967956543 y:1.5789999961853027 z:23.125999450683594
        - atom: C2 x: 13.718000411987305 y:0.5619999766349792 z:23.277999877929688
        - atom: O2 x: 13.458999633789062 y:-0.578000009059906 z:22.86400032043457
        - atom: N3 x: 14.899999618530273 y:0.8500000238418579 z:23.868999481201172
        - atom: C4 x: 15.147000312805176 y:2.0880000591278076 z:24.297000885009766
        - atom: N4 x: 16.325000762939453 y:2.3239998817443848 z:24.8700008392334
        - atom: C5 x: 14.196999549865723 y:3.1410000324249268 z:24.152000427246094
        - atom: C6 x: 13.029999732971191 y:2.8459999561309814 z:23.56599998474121
      - residue DC has 19 atoms
        - atom: P x: 6.784999847412109 y:1.5880000591278076 z:23.06800079345703
        - atom: OP1 x: 7.255000114440918 y:1.5880000591278076 z:24.479000091552734
        - atom: OP2 x: 5.660999774932861 y:0.6949999928474426 z:22.66699981689453
        - atom: O5' x: 6.434000015258789 y:3.0880000591278076 z:22.659000396728516
        - atom: C5' x: 5.370999813079834 y:3.378000020980835 z:21.74799919128418
        - atom: C4' x: 4.375999927520752 y:4.328000068664551 z:22.378000259399414
        - atom: O4' x: 3.687000036239624 y:3.677000045776367 z:23.465999603271484
        - atom: C3' x: 4.9770002365112305 y:5.60699987411499 z:22.972999572753906
        - atom: O3' x: 4.706999778747559 y:6.71999979019165 z:22.107999801635742
        - atom: C2' x: 4.288000106811523 y:5.76200008392334 z:24.326000213623047
        - atom: C1' x: 3.2070000171661377 y:4.689000129699707 z:24.322999954223633
        - atom: N1 x: 2.882999897003174 y:4.071000099182129 z:25.628000259399414
        - atom: C2 x: 3.9179999828338623 y:3.555999994277954 z:26.45199966430664
        - atom: O2 x: 5.10099983215332 y:3.6510000228881836 z:26.08799934387207
        - atom: N3 x: 3.5899999141693115 y:2.9709999561309814 z:27.625
        - atom: C4 x: 2.311000108718872 y:2.88700008392334 z:27.996999740600586
        - atom: N4 x: 2.0390000343322754 y:2.2960000038146973 z:29.16200065612793
        - atom: C5 x: 1.2519999742507935 y:3.4059998989105225 z:27.194000244140625
        - atom: C6 x: 1.5789999961853027 y:3.9860000610351562 z:26.031999588012695
      - residue DG has 22 atoms
        - atom: P x: 5.339000225067139 y:8.164999961853027 z:22.430999755859375
        - atom: OP1 x: 5.185999870300293 y:9.013999938964844 z:21.215999603271484
        - atom: OP2 x: 6.695000171661377 y:7.960000038146973 z:23.01799964904785
        - atom: O5' x: 4.388999938964844 y:8.75 z:23.570999145507812
        - atom: C5' x: 2.9639999866485596 y:8.717000007629395 z:23.433000564575195
        - atom: C4' x: 2.2890000343322754 y:8.987000465393066 z:24.761999130249023
        - atom: O4' x: 2.5959999561309814 y:7.940000057220459 z:25.718000411987305
        - atom: C3' x: 2.671999931335449 y:10.305999755859375 z:25.44499969482422
        - atom: O3' x: 1.5190000534057617 y:10.883999824523926 z:26.075000762939453
        - atom: C2' x: 3.6530001163482666 y:9.859000205993652 z:26.516000747680664
        - atom: C1' x: 3.0190000534057617 y:8.543000221252441 z:26.93000030517578
        - atom: N9 x: 3.871000051498413 y:7.5920000076293945 z:27.639999389648438
        - atom: C8 x: 5.236999988555908 y:7.434000015258789 z:27.535999298095703
        - atom: N7 x: 5.703999996185303 y:6.49399995803833 z:28.315000534057617
        - atom: C5 x: 4.581999778747559 y:5.999000072479248 z:28.972000122070312
        - atom: C6 x: 4.456999778747559 y:4.964000225067139 z:29.95199966430664
        - atom: O6 x: 5.3429999351501465 y:4.252999782562256 z:30.444000244140625
        - atom: N1 x: 3.134000062942505 y:4.795000076293945 z:30.350000381469727
        - atom: C2 x: 2.063999891281128 y:5.514999866485596 z:29.8700008392334
        - atom: N2 x: 0.8629999756813049 y:5.197000026702881 z:30.371000289916992
        - atom: N3 x: 2.1649999618530273 y:6.474999904632568 z:28.964000701904297
        - atom: C4 x: 3.443000078201294 y:6.664000034332275 z:28.562999725341797
      - residue DC has 19 atoms
        - atom: P x: 0.33799999952316284 y:11.519000053405762 z:25.18000030517578
        - atom: OP1 x: 0.1550000011920929 y:10.725000381469727 z:23.934999465942383
        - atom: OP2 x: 0.6060000061988831 y:12.97599983215332 z:25.08799934387207
        - atom: O5' x: -0.9620000123977661 y:11.310999870300293 z:26.07699966430664
        - atom: C5' x: -1.5479999780654907 y:10.01099967956543 z:26.243999481201172
        - atom: C4' x: -2.0759999752044678 y:9.840999603271484 z:27.652999877929688
        - atom: O4' x: -1.0989999771118164 y:9.121000289916992 z:28.450000762939453
        - atom: C3' x: -2.3559999465942383 y:11.156999588012695 z:28.393999099731445
        - atom: O3' x: -3.6589999198913574 y:11.140999794006348 z:28.993000030517578
        - atom: C2' x: -1.2630000114440918 y:11.21500015258789 z:29.448999404907227
        - atom: C1' x: -1.0080000162124634 y:9.743000030517578 z:29.716999053955078
        - atom: N1 x: 0.3089999854564667 y:9.418000221252441 z:30.30299949645996
        - atom: C2 x: 0.3610000014305115 y:8.574000358581543 z:31.42300033569336
        - atom: O2 x: -0.6980000138282776 y:8.114999771118164 z:31.885000228881836
        - atom: N3 x: 1.565000057220459 y:8.277999877929688 z:31.972000122070312
        - atom: C4 x: 2.681999921798706 y:8.782999992370605 z:31.444000244140625
        - atom: N4 x: 3.8420000076293945 y:8.456999778747559 z:32.00699996948242
        - atom: C5 x: 2.6589999198913574 y:9.640000343322754 z:30.309999465942383
        - atom: C6 x: 1.4630000591278076 y:9.928999900817871 z:29.774999618530273
      - residue DG has 22 atoms
        - atom: P x: -4.367000102996826 y:12.529000282287598 z:29.423999786376953
        - atom: OP1 x: -5.24399995803833 y:12.972000122070312 z:28.31399917602539
        - atom: OP2 x: -3.3519999980926514 y:13.472999572753906 z:29.975000381469727
        - atom: O5' x: -5.328999996185303 y:12.105999946594238 z:30.618999481201172
        - atom: C5' x: -5.7230000495910645 y:10.743000030517578 z:30.81599998474121
        - atom: C4' x: -5.9730000495910645 y:10.482000350952148 z:32.2859992980957
        - atom: O4' x: -4.754000186920166 y:10.02400016784668 z:32.917999267578125
        - atom: C3' x: -6.394000053405762 y:11.713000297546387 z:33.08300018310547
        - atom: O3' x: -7.164999961853027 y:11.305000305175781 z:34.207000732421875
        - atom: C2' x: -5.059999942779541 y:12.281000137329102 z:33.53200149536133
        - atom: C1' x: -4.284999847412109 y:11.005999565124512 z:33.8380012512207
        - atom: N9 x: -2.8359999656677246 y:11.102999687194824 z:33.691001892089844
        - atom: C8 x: -2.1500000953674316 y:11.842000007629395 z:32.762001037597656
        - atom: N7 x: -0.8539999723434448 y:11.725000381469727 z:32.86600112915039
        - atom: C5 x: -0.6690000295639038 y:10.854999542236328 z:33.930999755859375
        - atom: C6 x: 0.5249999761581421 y:10.35200023651123 z:34.5099983215332
        - atom: O6 x: 1.6929999589920044 y:10.571999549865723 z:34.17399978637695
        - atom: N1 x: 0.25699999928474426 y:9.508999824523926 z:35.584999084472656
        - atom: C2 x: -0.9919999837875366 y:9.182999610900879 z:36.04100036621094
        - atom: N2 x: -1.0390000343322754 y:8.371000289916992 z:37.106998443603516
        - atom: N3 x: -2.114000082015991 y:9.626999855041504 z:35.5
        - atom: C4 x: -1.8799999952316284 y:10.461000442504883 z:34.457000732421875
      - residue DC has 19 atoms
        - atom: P x: -7.857999801635742 y:12.404000282287598 z:35.13100051879883
        - atom: OP1 x: -9.21500015258789 y:11.907999992370605 z:35.45399856567383
        - atom: OP2 x: -7.696000099182129 y:13.723999977111816 z:34.48099899291992
        - atom: O5' x: -6.958000183105469 y:12.425999641418457 z:36.45100021362305
        - atom: C5' x: -7.033999919891357 y:11.376999855041504 z:37.417999267578125
        - atom: C4' x: -5.870999813079834 y:11.456999778747559 z:38.382999420166016
        - atom: O4' x: -4.645999908447266 y:11.569000244140625 z:37.64799880981445
        - atom: C3' x: -5.867000102996826 y:12.637999534606934 z:39.358001708984375
        - atom: O3' x: -6.331999778747559 y:12.196000099182129 z:40.64400100708008
        - atom: C2' x: -4.410999774932861 y:13.088000297546387 z:39.395999908447266
        - atom: C1' x: -3.680999994277954 y:12.074999809265137 z:38.53200149536133
        - atom: N1 x: -2.5789999961853027 y:12.61400032043457 z:37.72200012207031
        - atom: C2 x: -1.2640000581741333 y:12.213000297546387 z:38.012001037597656
        - atom: O2 x: -1.0640000104904175 y:11.440999984741211 z:38.959999084472656
        - atom: N3 x: -0.24699999392032623 y:12.678999900817871 z:37.25299835205078
        - atom: C4 x: -0.4959999918937683 y:13.519000053405762 z:36.24800109863281
        - atom: N4 x: 0.5400000214576721 y:13.949999809265137 z:35.527000427246094
        - atom: C5 x: -1.8209999799728394 y:13.954999923706055 z:35.93899917602539
        - atom: C6 x: -2.822999954223633 y:13.482999801635742 z:36.69499969482422
      - residue DA has 21 atoms
        - atom: P x: -6.264999866485596 y:13.177000045776367 z:41.92599868774414
        - atom: OP1 x: -7.065999984741211 y:12.534000396728516 z:43.00299835205078
        - atom: OP2 x: -6.591000080108643 y:14.555000305175781 z:41.50400161743164
        - atom: O5' x: -4.739999771118164 y:13.109999656677246 z:42.375999450683594
        - atom: C5' x: -4.144000053405762 y:11.85200023651123 z:42.70800018310547
        - atom: C4' x: -2.9830000400543213 y:12.027999877929688 z:43.66400146484375
        - atom: O4' x: -1.7519999742507935 y:12.300000190734863 z:42.95500183105469
        - atom: C3' x: -3.1029999256134033 y:13.125 z:44.70899963378906
        - atom: O3' x: -2.431999921798706 y:12.666999816894531 z:45.887001037597656
        - atom: C2' x: -2.390000104904175 y:14.291999816894531 z:44.04800033569336
        - atom: C1' x: -1.2949999570846558 y:13.611000061035156 z:43.23400115966797
        - atom: N9 x: -0.9739999771118164 y:14.23900032043457 z:41.952999114990234
        - atom: C8 x: -1.8300000429153442 y:14.854999542236328 z:41.07400131225586
        - atom: N7 x: -1.25 y:15.282999992370605 z:39.97800064086914
        - atom: C5 x: 0.07800000160932541 y:14.930999755859375 z:40.14799880981445
        - atom: C6 x: 1.2029999494552612 y:15.083999633789062 z:39.32500076293945
        - atom: N6 x: 1.1610000133514404 y:15.645000457763672 z:38.11600112915039
        - atom: N1 x: 2.38700008392334 y:14.62600040435791 z:39.78900146484375
        - atom: C2 x: 2.4230000972747803 y:14.048999786376953 z:40.99599838256836
        - atom: N3 x: 1.430999994277954 y:13.84000015258789 z:41.85900115966797
        - atom: C4 x: 0.26899999380111694 y:14.305000305175781 z:41.36800003051758
      - residue DT has 20 atoms
        - atom: P x: -2.188999891281128 y:13.661999702453613 z:47.132999420166016
        - atom: OP1 x: -2.315999984741211 y:12.843000411987305 z:48.37300109863281
        - atom: OP2 x: -2.986999988555908 y:14.913000106811523 z:47.0
        - atom: O5' x: -0.6570000052452087 y:14.04800033569336 z:46.965999603271484
        - atom: C5' x: 0.3330000042915344 y:13.050999641418457 z:46.792999267578125
        - atom: C4' x: 1.6670000553131104 y:13.706999778747559 z:46.54499816894531
        - atom: O4' x: 1.6430000066757202 y:14.303999900817871 z:45.2239990234375
        - atom: C3' x: 1.9980000257492065 y:14.854999542236328 z:47.505001068115234
        - atom: O3' x: 3.4089999198913574 y:14.859000205993652 z:47.75600051879883
        - atom: C2' x: 1.628999948501587 y:16.091999053955078 z:46.70199966430664
        - atom: C1' x: 2.1050000190734863 y:15.644000053405762 z:45.33000183105469
        - atom: N1 x: 1.6460000276565552 y:16.400999069213867 z:44.13199996948242
        - atom: C2 x: 2.572999954223633 y:16.636999130249023 z:43.12900161743164
        - atom: O2 x: 3.7309999465942383 y:16.2810001373291 z:43.194000244140625
        - atom: N3 x: 2.0889999866485596 y:17.312999725341797 z:42.03900146484375
        - atom: C4 x: 0.8059999942779541 y:17.77199935913086 z:41.84700012207031
        - atom: O4 x: 0.5199999809265137 y:18.349000930786133 z:40.797000885009766
        - atom: C5 x: -0.11999999731779099 y:17.506999969482422 z:42.948001861572266
        - atom: C7 x: -1.534999966621399 y:17.979000091552734 z:42.840999603271484
        - atom: C6 x: 0.3440000116825104 y:16.844999313354492 z:44.018001556396484
      - residue DC has 19 atoms
        - atom: P x: 3.9679999351501465 y:15.352999687194824 z:49.18199920654297
        - atom: OP1 x: 4.440999984741211 y:14.140000343322754 z:49.9010009765625
        - atom: OP2 x: 2.9700000286102295 y:16.26300048828125 z:49.823001861572266
        - atom: O5' x: 5.254000186920166 y:16.208999633789062 z:48.83000183105469
        - atom: C5' x: 6.129000186920166 y:15.824000358581543 z:47.78900146484375
        - atom: C4' x: 6.697999954223633 y:17.05900001525879 z:47.137001037597656
        - atom: O4' x: 5.788000106811523 y:17.520000457763672 z:46.10200119018555
        - atom: C3' x: 6.85699987411499 y:18.238000869750977 z:48.10900115966797
        - atom: O3' x: 8.050000190734863 y:18.95199966430664 z:47.797000885009766
        - atom: C2' x: 5.665999889373779 y:19.121000289916992 z:47.775001525878906
        - atom: C1' x: 5.61899995803833 y:18.917999267578125 z:46.27199935913086
        - atom: N1 x: 4.400000095367432 y:19.339000701904297 z:45.55400085449219
        - atom: C2 x: 4.5269999504089355 y:19.80699920654297 z:44.236000061035156
        - atom: O2 x: 5.656000137329102 y:19.850000381469727 z:43.71200180053711
        - atom: N3 x: 3.4189999103546143 y:20.195999145507812 z:43.56399917602539
        - atom: C4 x: 2.2239999771118164 y:20.1200008392334 z:44.14899826049805
        - atom: N4 x: 1.159999966621399 y:20.499000549316406 z:43.44300079345703
        - atom: C5 x: 2.065999984741211 y:19.648000717163086 z:45.48500061035156
        - atom: C6 x: 3.1689999103546143 y:19.274999618530273 z:46.145999908447266
      - residue DA has 21 atoms
        - atom: P x: 9.348999977111816 y:18.784000396728516 z:48.71699905395508
        - atom: OP1 x: 9.670999526977539 y:17.33099937438965 z:48.79199981689453
        - atom: OP2 x: 9.105999946594238 y:19.55500030517578 z:49.965999603271484
        - atom: O5' x: 10.47599983215332 y:19.483999252319336 z:47.83599853515625
        - atom: C5' x: 10.871000289916992 y:18.892000198364258 z:46.59400177001953
        - atom: C4' x: 11.45199966430664 y:19.92099952697754 z:45.64799880981445
        - atom: O4' x: 10.427000045776367 y:20.615999221801758 z:44.90599822998047
        - atom: C3' x: 12.335000038146973 y:21.007999420166016 z:46.249000549316406
        - atom: O3' x: 13.369999885559082 y:21.326000213623047 z:45.31800079345703
        - atom: C2' x: 11.381999969482422 y:22.177000045776367 z:46.426998138427734
        - atom: C1' x: 10.312000274658203 y:21.95800018310547 z:45.35599899291992
        - atom: N9 x: 8.944000244140625 y:22.131000518798828 z:45.83399963378906
        - atom: C8 x: 8.444000244140625 y:21.815000534057617 z:47.073001861572266
        - atom: N7 x: 7.1620001792907715 y:22.04400062561035 z:47.196998596191406
        - atom: C5 x: 6.795000076293945 y:22.551000595092773 z:45.95899963378906
        - atom: C6 x: 5.565000057220459 y:22.979999542236328 z:45.452999114990234
        - atom: N6 x: 4.434999942779541 y:22.95800018310547 z:46.16299819946289
        - atom: N1 x: 5.5329999923706055 y:23.437000274658203 z:44.18199920654297
        - atom: C2 x: 6.673999786376953 y:23.458999633789062 z:43.481998443603516
        - atom: N3 x: 7.896999835968018 y:23.07699966430664 z:43.85300064086914
        - atom: C4 x: 7.885000228881836 y:22.624000549316406 z:45.11600112915039
      - residue DG has 22 atoms
        - atom: P x: 14.439000129699707 y:22.465999603271484 z:45.67100143432617
        - atom: OP1 x: 15.732000350952148 y:22.033000946044922 z:45.07500076293945
        - atom: OP2 x: 14.36400032043457 y:22.801000595092773 z:47.12300109863281
        - atom: O5' x: 13.901000022888184 y:23.725000381469727 z:44.86199951171875
        - atom: C5' x: 13.479999542236328 y:23.606000900268555 z:43.500999450683594
        - atom: C4' x: 12.72700023651123 y:24.849000930786133 z:43.0880012512207
        - atom: O4' x: 11.375 y:24.797000885009766 z:43.606998443603516
        - atom: C3' x: 13.336999893188477 y:26.138999938964844 z:43.637001037597656
        - atom: O3' x: 13.461999893188477 y:27.09600067138672 z:42.59199905395508
        - atom: C2' x: 12.329000473022461 y:26.611000061035156 z:44.67499923706055
        - atom: C1' x: 11.03499984741211 y:26.066999435424805 z:44.11199951171875
        - atom: N9 x: 9.951000213623047 y:25.892000198364258 z:45.073001861572266
        - atom: C8 x: 10.029000282287598 y:25.426000595092773 z:46.36800003051758
        - atom: N7 x: 8.871000289916992 y:25.405000686645508 z:46.97800064086914
        - atom: C5 x: 7.974999904632568 y:25.875999450683594 z:46.02299880981445
        - atom: C6 x: 6.565999984741211 y:26.079999923706055 z:46.090999603271484
        - atom: O6 x: 5.789000034332275 y:25.85099983215332 z:47.0369987487793
        - atom: N1 x: 6.070000171661377 y:26.593000411987305 z:44.902000427246094
        - atom: C2 x: 6.811999797821045 y:26.860000610351562 z:43.779998779296875
        - atom: N2 x: 6.139999866485596 y:27.356000900268555 z:42.720001220703125
        - atom: N3 x: 8.112000465393066 y:26.660999298095703 z:43.69499969482422
        - atom: C4 x: 8.626999855041504 y:26.17799949645996 z:44.845001220703125
      - residue DC has 19 atoms
        - atom: P x: 14.321999549865723 y:28.42799949645996 z:42.8380012512207
        - atom: OP1 x: 15.064000129699707 y:28.68000030517578 z:41.57600021362305
        - atom: OP2 x: 15.067000389099121 y:28.295000076293945 z:44.112998962402344
        - atom: O5' x: 13.229000091552734 y:29.56800079345703 z:43.03499984741211
        - atom: C5' x: 12.413000106811523 y:29.974000930786133 z:41.94300079345703
        - atom: C4' x: 11.097000122070312 y:30.51300048828125 z:42.446998596191406
        - atom: O4' x: 10.517000198364258 y:29.645000457763672 z:43.43600082397461
        - atom: C3' x: 11.199999809265137 y:31.851999282836914 z:43.159000396728516
        - atom: O3' x: 11.206000328063965 y:32.849998474121094 z:42.15399932861328
        - atom: C2' x: 9.986000061035156 y:31.849000930786133 z:44.07699966430664
        - atom: C1' x: 9.475000381469727 y:30.405000686645508 z:44.016998291015625
        - atom: N1 x: 9.112000465393066 y:29.808000564575195 z:45.314998626708984
        - atom: C2 x: 7.763000011444092 y:29.753999710083008 z:45.65299987792969
        - atom: O2 x: 6.926000118255615 y:30.17300033569336 z:44.83599853515625
        - atom: N3 x: 7.3979997634887695 y:29.2450008392334 z:46.8489990234375
        - atom: C4 x: 8.324999809265137 y:28.78700065612793 z:47.6870002746582
        - atom: N4 x: 7.909999847412109 y:28.29199981689453 z:48.85599899291992
        - atom: C5 x: 9.71399974822998 y:28.812999725341797 z:47.36399841308594
        - atom: C6 x: 10.059000015258789 y:29.32699966430664 z:46.17900085449219
      - residue MN has 1 atoms
        - atom: MN x: 23.54800033569336 y:1.0 z:22.975000381469727
      - residue HOH has 1 atoms
        - atom: O x: -0.03799999877810478 y:22.62299919128418 z:45.85499954223633
      - residue HOH has 1 atoms
        - atom: O x: -0.2680000066757202 y:6.394999980926514 z:26.27400016784668
      - residue HOH has 1 atoms
        - atom: O x: -2.617000102996826 y:17.14299964904785 z:38.38199996948242
      - residue HOH has 1 atoms
        - atom: O x: -2.8450000286102295 y:9.204000473022461 z:40.37200164794922
      - residue HOH has 1 atoms
        - atom: O x: -4.395999908447266 y:15.696999549865723 z:41.887001037597656
      - residue HOH has 1 atoms
        - atom: O x: 8.746000289916992 y:3.684000015258789 z:24.974000930786133
      - residue HOH has 1 atoms
        - atom: O x: 20.542999267578125 y:3.009999990463257 z:24.375
      - residue HOH has 1 atoms
        - atom: O x: -6.396999835968018 y:10.779000282287598 z:28.01799964904785
      - residue HOH has 1 atoms
        - atom: O x: -9.277000427246094 y:15.675000190734863 z:35.47200012207031
      - residue HOH has 1 atoms
        - atom: O x: 6.900000095367432 y:24.628000259399414 z:49.99599838256836
      - residue HOH has 1 atoms
        - atom: O x: 30.777999877929688 y:4.184000015258789 z:16.06800079345703
      - residue HOH has 1 atoms
        - atom: O x: 14.788999557495117 y:20.408000946044922 z:42.99700164794922
      - residue HOH has 1 atoms
        - atom: O x: -2.247999906539917 y:17.725000381469727 z:46.025001525878906
      - residue HOH has 1 atoms
        - atom: O x: 25.37700080871582 y:2.634999990463257 z:22.086999893188477
      - residue HOH has 1 atoms
        - atom: O x: 24.393999099731445 y:-1.1100000143051147 z:22.084999084472656
      - residue HOH has 1 atoms
        - atom: O x: 5.159999847412109 y:11.8100004196167 z:48.76900100708008
      - residue HOH has 1 atoms
        - atom: O x: -1.069000005722046 y:4.329999923706055 z:24.06399917602539
      - residue HOH has 1 atoms
        - atom: O x: -0.26600000262260437 y:7.039999961853027 z:23.948999404907227
      - residue HOH has 1 atoms
        - atom: O x: 7.377999782562256 y:9.512999534606934 z:17.650999069213867
      - residue HOH has 1 atoms
        - atom: O x: 9.468000411987305 y:9.222999572753906 z:19.29199981689453
      - residue HOH has 1 atoms
        - atom: O x: 10.92199993133545 y:19.01799964904785 z:41.494998931884766
      - residue HOH has 1 atoms
        - atom: O x: -5.491000175476074 y:14.925999641418457 z:35.11899948120117
      - residue HOH has 1 atoms
        - atom: O x: -8.88599967956543 y:16.402999877929688 z:38.94599914550781
      - residue HOH has 1 atoms
        - atom: O x: -9.723999977111816 y:17.750999450683594 z:33.974998474121094
 - chain  <Chain id=P> has 18 residues
      - residue DG has 19 atoms
        - atom: O5' x: -2.617000102996826 y:29.32900047302246 z:49.946998596191406
        - atom: C5' x: -3.3010001182556152 y:30.40399932861328 z:49.26599884033203
        - atom: C4' x: -2.434000015258789 y:30.941999435424805 z:48.154998779296875
        - atom: O4' x: -1.0850000381469727 y:30.972999572753906 z:48.6510009765625
        - atom: C3' x: -2.38700008392334 y:30.049999237060547 z:46.91699981689453
        - atom: O3' x: -3.3589999675750732 y:30.52400016784668 z:45.96099853515625
        - atom: C2' x: -0.9549999833106995 y:30.20599937438965 z:46.415000915527344
        - atom: C1' x: -0.17599999904632568 y:30.812999725341797 z:47.584999084472656
        - atom: N9 x: 0.9449999928474426 y:30.017000198364258 z:48.07699966430664
        - atom: C8 x: 0.9980000257492065 y:29.2549991607666 z:49.22100067138672
        - atom: N7 x: 2.1589999198913574 y:28.683000564575195 z:49.40299987792969
        - atom: C5 x: 2.9100000858306885 y:29.089000701904297 z:48.3129997253418
        - atom: C6 x: 4.244999885559082 y:28.812999725341797 z:47.972999572753906
        - atom: O6 x: 5.076000213623047 y:28.15399932861328 z:48.59700012207031
        - atom: N1 x: 4.5980000495910645 y:29.413999557495117 z:46.77299880981445
        - atom: C2 x: 3.7769999504089355 y:30.197999954223633 z:46.01499938964844
        - atom: N2 x: 4.291999816894531 y:30.69099998474121 z:44.88600158691406
        - atom: N3 x: 2.5409998893737793 y:30.482999801635742 z:46.33399963378906
        - atom: C4 x: 2.1710000038146973 y:29.89900016784668 z:47.481998443603516
      - residue DC has 19 atoms
        - atom: P x: -3.7049999237060547 y:29.652999877929688 z:44.64699935913086
        - atom: OP1 x: -4.730999946594238 y:30.423999786376953 z:43.893001556396484
        - atom: OP2 x: -3.9800000190734863 y:28.243000030517578 z:45.04199981689453
        - atom: O5' x: -2.365999937057495 y:29.698999404907227 z:43.7859992980957
        - atom: C5' x: -1.8380000591278076 y:30.945999145507812 z:43.33399963378906
        - atom: C4' x: -0.75 y:30.716999053955078 z:42.310001373291016
        - atom: O4' x: 0.4480000138282776 y:30.246000289916992 z:42.97100067138672
        - atom: C3' x: -1.0950000286102295 y:29.672000885009766 z:41.250999450683594
        - atom: O3' x: -0.6209999918937683 y:30.075000762939453 z:39.96699905395508
        - atom: C2' x: -0.3880000114440918 y:28.417999267578125 z:41.731998443603516
        - atom: C1' x: 0.8130000233650208 y:28.95599937438965 z:42.499000549316406
        - atom: N1 x: 1.187000036239624 y:28.141000747680664 z:43.66999816894531
        - atom: C2 x: 2.503999948501587 y:27.666000366210938 z:43.784000396728516
        - atom: O2 x: 3.3299999237060547 y:27.927000045776367 z:42.89099884033203
        - atom: N3 x: 2.8429999351501465 y:26.937000274658203 z:44.86800003051758
        - atom: C4 x: 1.9320000410079956 y:26.677000045776367 z:45.81399917602539
        - atom: N4 x: 2.319999933242798 y:25.972000122070312 z:46.88399887084961
        - atom: C5 x: 0.5879999995231628 y:27.132999420166016 z:45.71099853515625
        - atom: C6 x: 0.2630000114440918 y:27.854000091552734 z:44.63600158691406
      - residue DT has 20 atoms
        - atom: P x: -0.828000009059906 y:29.101999282836914 z:38.70800018310547
        - atom: OP1 x: -0.8669999837875366 y:29.930999755859375 z:37.46799850463867
        - atom: OP2 x: -1.9559999704360962 y:28.173999786376953 z:39.0099983215332
        - atom: O5' x: 0.5260000228881836 y:28.270999908447266 z:38.683998107910156
        - atom: C5' x: 1.777999997138977 y:28.93600082397461 z:38.53799819946289
        - atom: C4' x: 2.8570001125335693 y:27.93600082397461 z:38.20399856567383
        - atom: O4' x: 3.250999927520752 y:27.259000778198242 z:39.422000885009766
        - atom: C3' x: 2.3949999809265137 y:26.836000442504883 z:37.24700164794922
        - atom: O3' x: 3.496999979019165 y:26.400999069213867 z:36.444000244140625
        - atom: C2' x: 1.9589999914169312 y:25.736000061035156 z:38.19599914550781
        - atom: C1' x: 3.0169999599456787 y:25.868000030517578 z:39.27899932861328
        - atom: N1 x: 2.696000099182129 y:25.316999435424805 z:40.617000579833984
        - atom: C2 x: 3.7639999389648438 y:24.950000762939453 z:41.40399932861328
        - atom: O2 x: 4.928999900817871 y:25.084999084472656 z:41.055999755859375
        - atom: N3 x: 3.421999931335449 y:24.41900062561035 z:42.61800003051758
        - atom: C4 x: 2.1570000648498535 y:24.222000122070312 z:43.119998931884766
        - atom: O4 x: 2.010999917984009 y:23.68400001525879 z:44.21900177001953
        - atom: C5 x: 1.0809999704360962 y:24.665000915527344 z:42.263999938964844
        - atom: C7 x: -0.328000009059906 y:24.54599952697754 z:42.757999420166016
        - atom: C6 x: 1.3980000019073486 y:25.173999786376953 z:41.064998626708984
      - residue DG has 22 atoms
        - atom: P x: 3.2839999198913574 y:26.125 z:34.874000549316406
        - atom: OP1 x: 2.9730000495910645 y:27.427000045776367 z:34.23400115966797
        - atom: OP2 x: 2.3570001125335693 y:24.972999572753906 z:34.70800018310547
        - atom: O5' x: 4.7270002365112305 y:25.694000244140625 z:34.374000549316406
        - atom: C5' x: 5.872000217437744 y:26.429000854492188 z:34.78499984741211
        - atom: C4' x: 6.8429999351501465 y:25.516000747680664 z:35.494998931884766
        - atom: O4' x: 6.228000164031982 y:24.899999618530273 z:36.65399932861328
        - atom: C3' x: 7.355000019073486 y:24.358999252319336 z:34.64799880981445
        - atom: O3' x: 8.71399974822998 y:24.148000717163086 z:35.01499938964844
        - atom: C2' x: 6.465000152587891 y:23.198999404907227 z:35.07500076293945
        - atom: C1' x: 6.324999809265137 y:23.479999542236328 z:36.55500030517578
        - atom: N9 x: 5.156000137329102 y:22.92099952697754 z:37.22999954223633
        - atom: C8 x: 3.8529999256134033 y:22.968000411987305 z:36.803001403808594
        - atom: N7 x: 3.006999969482422 y:22.51300048828125 z:37.68600082397461
        - atom: C5 x: 3.7990000247955322 y:22.11199951171875 z:38.75199890136719
        - atom: C6 x: 3.437000036239624 y:21.558000564575195 z:40.00899887084961
        - atom: O6 x: 2.309999942779541 y:21.3439998626709 z:40.45800018310547
        - atom: N1 x: 4.552999973297119 y:21.260000228881836 z:40.77899932861328
        - atom: C2 x: 5.854000091552734 y:21.476999282836914 z:40.400001525878906
        - atom: N2 x: 6.788000106811523 y:21.107999801635742 z:41.284000396728516
        - atom: N3 x: 6.209000110626221 y:22.014999389648438 z:39.24100112915039
        - atom: C4 x: 5.132999897003174 y:22.309999465942383 z:38.47100067138672
      - residue DA has 21 atoms
        - atom: P x: 9.545999526977539 y:22.961999893188477 z:34.34600067138672
        - atom: OP1 x: 10.937999725341797 y:23.468000411987305 z:34.21900177001953
        - atom: OP2 x: 8.817999839782715 y:22.490999221801758 z:33.14099884033203
        - atom: O5' x: 9.5 y:21.81399917602539 z:35.448001861572266
        - atom: C5' x: 10.081000328063965 y:22.02400016784668 z:36.736000061035156
        - atom: C4' x: 10.329000473022461 y:20.70199966430664 z:37.426998138427734
        - atom: O4' x: 9.138999938964844 y:20.261999130249023 z:38.12099838256836
        - atom: C3' x: 10.741000175476074 y:19.54400062561035 z:36.52299880981445
        - atom: O3' x: 11.741999626159668 y:18.784000396728516 z:37.20500183105469
        - atom: C2' x: 9.444000244140625 y:18.773000717163086 z:36.327999114990234
        - atom: C1' x: 8.732000350952148 y:18.981000900268555 z:37.65599822998047
        - atom: N9 x: 7.264999866485596 y:18.985000610351562 z:37.60900115966797
        - atom: C8 x: 6.453999996185303 y:19.448999404907227 z:36.606998443603516
        - atom: N7 x: 5.175000190734863 y:19.384000778198242 z:36.88800048828125
        - atom: C5 x: 5.138000011444092 y:18.83099937438965 z:38.15700149536133
        - atom: C6 x: 4.072999954223633 y:18.517000198364258 z:39.018001556396484
        - atom: N6 x: 2.7899999618530273 y:18.732999801635742 z:38.7239990234375
        - atom: N1 x: 4.375 y:17.97100067138672 z:40.21099853515625
        - atom: C2 x: 5.659999847412109 y:17.757999420166016 z:40.50899887084961
        - atom: N3 x: 6.749000072479248 y:18.011999130249023 z:39.78799819946289
        - atom: C4 x: 6.415999889373779 y:18.558000564575195 z:38.606998443603516
      - residue DT has 20 atoms
        - atom: P x: 12.317000389099121 y:17.43600082397461 z:36.55500030517578
        - atom: OP1 x: 13.734999656677246 y:17.33300018310547 z:36.98099899291992
        - atom: OP2 x: 11.979999542236328 y:17.409000396728516 z:35.11199951171875
        - atom: O5' x: 11.479000091552734 y:16.302000045776367 z:37.290000915527344
        - atom: C5' x: 11.32800006866455 y:16.334999084472656 z:38.70600128173828
        - atom: C4' x: 10.307000160217285 y:15.317999839782715 z:39.159000396728516
        - atom: O4' x: 8.970999717712402 y:15.774999618530273 z:38.867000579833984
        - atom: C3' x: 10.42199993133545 y:13.913000106811523 z:38.55099868774414
        - atom: O3' x: 10.61299991607666 y:12.967000007629395 z:39.61199951171875
        - atom: C2' x: 9.071999549865723 y:13.696999549865723 z:37.87799835205078
        - atom: C1' x: 8.182999610900879 y:14.621000289916992 z:38.68199920654297
        - atom: N1 x: 6.90500020980835 y:15.03499984741211 z:38.07099914550781
        - atom: C2 x: 5.755000114440918 y:14.852999687194824 z:38.80699920654297
        - atom: O2 x: 5.739999771118164 y:14.33899974822998 z:39.91299819946289
        - atom: N3 x: 4.610000133514404 y:15.300000190734863 z:38.196998596191406
        - atom: C4 x: 4.497000217437744 y:15.899999618530273 z:36.95600128173828
        - atom: O4 x: 3.3940000534057617 y:16.273000717163086 z:36.55699920654297
        - atom: C5 x: 5.741000175476074 y:16.042999267578125 z:36.229000091552734
        - atom: C7 x: 5.723999977111816 y:16.673999786376953 z:34.87300109863281
        - atom: C6 x: 6.864999771118164 y:15.604000091552734 z:36.8129997253418
      - residue DG has 22 atoms
        - atom: P x: 11.225000381469727 y:11.51099967956543 z:39.29899978637695
        - atom: OP1 x: 12.70300006866455 y:11.628000259399414 z:39.255001068115234
        - atom: OP2 x: 10.50100040435791 y:10.935999870300293 z:38.132999420166016
        - atom: O5' x: 10.819999694824219 y:10.654000282287598 z:40.57899856567383
        - atom: C5' x: 10.031000137329102 y:11.215999603271484 z:41.62900161743164
        - atom: C4' x: 8.626999855041504 y:10.654999732971191 z:41.597999572753906
        - atom: O4' x: 7.829999923706055 y:11.324000358581543 z:40.608001708984375
        - atom: C3' x: 8.498000144958496 y:9.168999671936035 z:41.27399826049805
        - atom: O3' x: 8.227999687194824 y:8.444999694824219 z:42.47800064086914
        - atom: C2' x: 7.328999996185303 y:9.090999603271484 z:40.29499816894531
        - atom: C1' x: 6.724999904632568 y:10.484000205993652 z:40.34600067138672
        - atom: N9 x: 6.067999839782715 y:10.968999862670898 z:39.12699890136719
        - atom: C8 x: 6.690000057220459 y:11.46500015258789 z:38.00699996948242
        - atom: N7 x: 5.853000164031982 y:11.904000282287598 z:37.10599899291992
        - atom: C5 x: 4.598999977111816 y:11.670999526977539 z:37.6510009765625
        - atom: C6 x: 3.306999921798706 y:11.958000183105469 z:37.13800048828125
        - atom: O6 x: 2.999000072479248 y:12.503999710083008 z:36.073001861572266
        - atom: N1 x: 2.312000036239624 y:11.548999786376953 z:38.00899887084961
        - atom: C2 x: 2.5190000534057617 y:10.954000473022461 z:39.215999603271484
        - atom: N2 x: 1.4140000343322754 y:10.656999588012695 z:39.900001525878906
        - atom: N3 x: 3.7149999141693115 y:10.678999900817871 z:39.7130012512207
        - atom: C4 x: 4.704999923706055 y:11.067999839782715 z:38.88600158691406
      - residue DC has 19 atoms
        - atom: P x: 8.17199993133545 y:6.841000080108643 z:42.446998596191406
        - atom: OP1 x: 8.222999572753906 y:6.381999969482422 z:43.845001220703125
        - atom: OP2 x: 9.154999732971191 y:6.321000099182129 z:41.47800064086914
        - atom: O5' x: 6.704999923706055 y:6.544000148773193 z:41.90299987792969
        - atom: C5' x: 5.586999893188477 y:6.679999828338623 z:42.770999908447266
        - atom: C4' x: 4.313000202178955 y:6.329999923706055 z:42.04499816894531
        - atom: O4' x: 4.117000102996826 y:7.260000228881836 z:40.965999603271484
        - atom: C3' x: 4.315999984741211 y:4.946000099182129 z:41.40299987792969
        - atom: O3' x: 3.621000051498413 y:4.050000190734863 z:42.27799987792969
        - atom: C2' x: 3.617000102996826 y:5.1479997634887695 z:40.055999755859375
        - atom: C1' x: 3.2750000953674316 y:6.645999908447266 z:40.01100158691406
        - atom: N1 x: 3.4820001125335693 y:7.343999862670898 z:38.71900177001953
        - atom: C2 x: 2.378000020980835 y:7.947999954223633 z:38.071998596191406
        - atom: O2 x: 1.2549999952316284 y:7.870999813079834 z:38.58700180053711
        - atom: N3 x: 2.571000099182129 y:8.600000381469727 z:36.9109992980957
        - atom: C4 x: 3.7929999828338623 y:8.67300033569336 z:36.38600158691406
        - atom: N4 x: 3.941999912261963 y:9.338000297546387 z:35.24399948120117
        - atom: C5 x: 4.923999786376953 y:8.069000244140625 z:37.013999938964844
        - atom: C6 x: 4.724999904632568 y:7.420000076293945 z:38.16299819946289
      - residue DG has 22 atoms
        - atom: P x: 3.5369999408721924 y:2.490000009536743 z:41.92900085449219
        - atom: OP1 x: 3.2130000591278076 y:1.7960000038146973 z:43.191001892089844
        - atom: OP2 x: 4.730999946594238 y:2.0999999046325684 z:41.15800094604492
        - atom: O5' x: 2.25 y:2.365000009536743 z:41.00199890136719
        - atom: C5' x: 0.9470000267028809 y:2.680999994277954 z:41.50899887084961
        - atom: C4' x: -0.08699999749660492 y:2.5480000972747803 z:40.415000915527344
        - atom: O4' x: 0.22200000286102295 y:3.51200008392334 z:39.380001068115234
        - atom: C3' x: -0.08799999952316284 y:1.1829999685287476 z:39.724998474121094
        - atom: O3' x: -1.4179999828338623 y:0.8140000104904175 z:39.356998443603516
        - atom: C2' x: 0.7760000228881836 y:1.4210000038146973 z:38.50400161743164
        - atom: C1' x: 0.375 y:2.8369998931884766 z:38.14500045776367
        - atom: N9 x: 1.3359999656677246 y:3.5820000171661377 z:37.33599853515625
        - atom: C8 x: 2.7079999446868896 y:3.490000009536743 z:37.36399841308594
        - atom: N7 x: 3.2909998893737793 y:4.26800012588501 z:36.49399948120117
        - atom: C5 x: 2.243000030517578 y:4.920000076293945 z:35.858001708984375
        - atom: C6 x: 2.259000062942505 y:5.873000144958496 z:34.814998626708984
        - atom: O6 x: 3.2360000610351562 y:6.339000225067139 z:34.21500015258789
        - atom: N1 x: 0.9739999771118164 y:6.2789998054504395 z:34.470001220703125
        - atom: C2 x: -0.17900000512599945 y:5.818999767303467 z:35.04999923706055
        - atom: N2 x: -1.3250000476837158 y:6.327000141143799 z:34.58100128173828
        - atom: N3 x: -0.20900000631809235 y:4.921999931335449 z:36.020999908447266
        - atom: C4 x: 1.031999945640564 y:4.517000198364258 z:36.37200164794922
      - residue DC has 19 atoms
        - atom: P x: -1.694000005722046 y:-0.6140000224113464 z:38.65599822998047
        - atom: OP1 x: -2.994999885559082 y:-1.1480000019073486 z:39.14899826049805
        - atom: OP2 x: -0.46000000834465027 y:-1.430999994277954 z:38.821998596191406
        - atom: O5' x: -1.8730000257492065 y:-0.24400000274181366 z:37.11000061035156
        - atom: C5' x: -2.808000087738037 y:0.7670000195503235 z:36.698001861572266
        - atom: C4' x: -2.8580000400543213 y:0.8840000033378601 z:35.1879997253418
        - atom: O4' x: -1.7769999504089355 y:1.7239999771118164 z:34.69900131225586
        - atom: C3' x: -2.756999969482422 y:-0.4309999942779541 z:34.39899826049805
        - atom: O3' x: -3.569999933242798 y:-0.4269999861717224 z:33.20000076293945
        - atom: C2' x: -1.312000036239624 y:-0.4320000112056732 z:33.9370002746582
        - atom: C1' x: -1.125 y:1.0440000295639038 z:33.637001037597656
        - atom: N1 x: 0.2680000066757202 y:1.524999976158142 z:33.55699920654297
        - atom: C2 x: 0.5590000152587891 y:2.6029999256134033 z:32.71099853515625
        - atom: O2 x: -0.36800000071525574 y:3.1510000228881836 z:32.09000015258789
        - atom: N3 x: 1.8370000123977661 y:3.0220000743865967 z:32.59600067138672
        - atom: C4 x: 2.8010001182556152 y:2.4200000762939453 z:33.29399871826172
        - atom: N4 x: 4.046999931335449 y:2.8559999465942383 z:33.137001037597656
        - atom: C5 x: 2.5299999713897705 y:1.3420000076293945 z:34.178001403808594
        - atom: C6 x: 1.2660000324249268 y:0.9300000071525574 z:34.27899932861328
      - residue MN has 1 atoms
        - atom: MN x: -0.07199999690055847 y:21.77899932861328 z:37.319000244140625
      - residue HOH has 1 atoms
        - atom: O x: 6.046000003814697 y:3.1649999618530273 z:39.082000732421875
      - residue HOH has 1 atoms
        - atom: O x: 13.569999694824219 y:10.14799976348877 z:41.25299835205078
      - residue HOH has 1 atoms
        - atom: O x: -5.609000205993652 y:-0.41600000858306885 z:34.5
      - residue HOH has 1 atoms
        - atom: O x: 4.633999824523926 y:30.27400016784668 z:40.766998291015625
      - residue HOH has 1 atoms
        - atom: O x: -5.763999938964844 y:33.71799850463867 z:44.33599853515625
      - residue HOH has 1 atoms
        - atom: O x: 2.937000036239624 y:31.315000534057617 z:42.645999908447266
      - residue HOH has 1 atoms
        - atom: O x: 7.23199987411499 y:5.645999908447266 z:38.564998626708984
 - chain  <Chain id=D> has 9 residues
      - residue DG has 23 atoms
        - atom: OP3 x: 21.908000946044922 y:-5.788000106811523 z:31.12700080871582
        - atom: P x: 22.32200050354004 y:-5.873000144958496 z:29.663000106811523
        - atom: OP1 x: 23.104999542236328 y:-4.658999919891357 z:29.17799949645996
        - atom: OP2 x: 22.988000869750977 y:-7.199999809265137 z:29.34600067138672
        - atom: O5' x: 20.930999755859375 y:-5.881999969482422 z:28.815000534057617
        - atom: C5' x: 19.81999969482422 y:-6.675000190734863 z:29.256000518798828
        - atom: C4' x: 19.066999435424805 y:-7.238999843597412 z:28.073999404907227
        - atom: O4' x: 18.231000900268555 y:-6.247000217437744 z:27.457000732421875
        - atom: C3' x: 19.908000946044922 y:-7.807000160217285 z:26.941999435424805
        - atom: O3' x: 19.149999618530273 y:-8.842000007629395 z:26.315000534057617
        - atom: C2' x: 20.09000015258789 y:-6.60699987411499 z:26.030000686645508
        - atom: C1' x: 18.798999786376953 y:-5.822999954223633 z:26.229999542236328
        - atom: N9 x: 18.93199920654297 y:-4.373000144958496 z:26.301000595092773
        - atom: C8 x: 19.9060001373291 y:-3.635999917984009 z:26.934999465942383
        - atom: N7 x: 19.700000762939453 y:-2.3499999046325684 z:26.86199951171875
        - atom: C5 x: 18.525999069213867 y:-2.2360000610351562 z:26.134000778198242
        - atom: C6 x: 17.79400062561035 y:-1.0950000286102295 z:25.75200080871582
        - atom: O6 x: 18.014999389648438 y:0.0860000029206276 z:26.02899932861328
        - atom: N1 x: 16.68000030517578 y:-1.4359999895095825 z:24.983999252319336
        - atom: C2 x: 16.304000854492188 y:-2.7179999351501465 z:24.660999298095703
        - atom: N2 x: 15.206000328063965 y:-2.86299991607666 z:23.91699981689453
        - atom: N3 x: 16.96299934387207 y:-3.7890000343322754 z:25.04400062561035
        - atom: C4 x: 18.05699920654297 y:-3.4769999980926514 z:25.764999389648438
      - residue DT has 20 atoms
        - atom: P x: 19.722999572753906 y:-9.595000267028809 z:25.020999908447266
        - atom: OP1 x: 19.643999099731445 y:-11.03600025177002 z:25.367000579833984
        - atom: OP2 x: 21.0049991607666 y:-9.012999534606934 z:24.559999465942383
        - atom: O5' x: 18.625999450683594 y:-9.286999702453613 z:23.91699981689453
        - atom: C5' x: 17.94099998474121 y:-8.050000190734863 z:23.905000686645508
        - atom: C4' x: 17.011999130249023 y:-7.999000072479248 z:22.722000122070312
        - atom: O4' x: 16.64699935913086 y:-6.625 z:22.472999572753906
        - atom: C3' x: 17.648000717163086 y:-8.508000373840332 z:21.43199920654297
        - atom: O3' x: 16.665000915527344 y:-9.154999732971191 z:20.62299919128418
        - atom: C2' x: 18.21299934387207 y:-7.251999855041504 z:20.790000915527344
        - atom: C1' x: 17.34600067138672 y:-6.119999885559082 z:21.343000411987305
        - atom: N1 x: 18.05500030517578 y:-4.886000156402588 z:21.767000198364258
        - atom: C2 x: 17.41699981689453 y:-3.680999994277954 z:21.559999465942383
        - atom: O2 x: 16.343000411987305 y:-3.5769999027252197 z:20.979000091552734
        - atom: N3 x: 18.089000701904297 y:-2.5910000801086426 z:22.051000595092773
        - atom: C4 x: 19.31100082397461 y:-2.578000068664551 z:22.687000274658203
        - atom: O4 x: 19.77400016784668 y:-1.5240000486373901 z:23.097999572753906
        - atom: C5 x: 19.947999954223633 y:-3.859999895095825 z:22.822999954223633
        - atom: C7 x: 21.301000595092773 y:-3.927000045776367 z:23.461000442504883
        - atom: C6 x: 19.29599952697754 y:-4.940000057220459 z:22.368000030517578
      - residue DC has 19 atoms
        - atom: P x: 17.084999084472656 y:-9.819999694824219 z:19.219999313354492
        - atom: OP1 x: 16.177000045776367 y:-10.982000350952148 z:18.999000549316406
        - atom: OP2 x: 18.55699920654297 y:-10.012999534606934 z:19.167999267578125
        - atom: O5' x: 16.697999954223633 y:-8.699999809265137 z:18.16200065612793
        - atom: C5' x: 15.357000350952148 y:-8.246999740600586 z:18.04599952697754
        - atom: C4' x: 15.291000366210938 y:-7.078000068664551 z:17.093000411987305
        - atom: O4' x: 15.998000144958496 y:-5.955999851226807 z:17.679000854492188
        - atom: C3' x: 15.972000122070312 y:-7.322999954223633 z:15.744999885559082
        - atom: O3' x: 15.348999977111816 y:-6.510000228881836 z:14.746000289916992
        - atom: C2' x: 17.37299919128418 y:-6.801000118255615 z:15.98900032043457
        - atom: C1' x: 17.03700065612793 y:-5.560999870300293 z:16.798999786376953
        - atom: N1 x: 18.117000579833984 y:-4.954999923706055 z:17.600000381469727
        - atom: C2 x: 18.066999435424805 y:-3.5810000896453857 z:17.847000122070312
        - atom: O2 x: 17.121999740600586 y:-2.9189999103546143 z:17.381999969482422
        - atom: N3 x: 19.047000885009766 y:-3.00600004196167 z:18.57200050354004
        - atom: C4 x: 20.05699920654297 y:-3.744999885559082 z:19.03499984741211
        - atom: N4 x: 21.01300048828125 y:-3.13100004196167 z:19.738000869750977
        - atom: C5 x: 20.13599967956543 y:-5.1479997634887695 z:18.79599952697754
        - atom: C6 x: 19.152999877929688 y:-5.706999778747559 z:18.086000442504883
      - residue DG has 22 atoms
        - atom: P x: 15.234000205993652 y:-7.048999786376953 z:13.239999771118164
        - atom: OP1 x: 14.206999778747559 y:-8.126999855041504 z:13.246000289916992
        - atom: OP2 x: 16.608999252319336 y:-7.3379998207092285 z:12.744999885559082
        - atom: O5' x: 14.673999786376953 y:-5.798999786376953 z:12.423999786376953
        - atom: C5' x: 13.835000038146973 y:-4.823999881744385 z:13.045000076293945
        - atom: C4' x: 14.350000381469727 y:-3.431999921798706 z:12.758999824523926
        - atom: O4' x: 15.515000343322754 y:-3.1540000438690186 z:13.57800006866455
        - atom: C3' x: 14.777999877929688 y:-3.1989998817443848 z:11.3100004196167
        - atom: O3' x: 14.291000366210938 y:-1.9329999685287476 z:10.85200023651123
        - atom: C2' x: 16.29599952697754 y:-3.2109999656677246 z:11.37399959564209
        - atom: C1' x: 16.589000701904297 y:-2.687999963760376 z:12.770999908447266
        - atom: N9 x: 17.82900047302246 y:-3.2009999752044678 z:13.35200023651123
        - atom: C8 x: 18.270000457763672 y:-4.50600004196167 z:13.321000099182129
        - atom: N7 x: 19.4060001373291 y:-4.679999828338623 z:13.937999725341797
        - atom: C5 x: 19.740999221801758 y:-3.4179999828338623 z:14.406999588012695
        - atom: C6 x: 20.8700008392334 y:-2.99399995803833 z:15.142999649047852
        - atom: O6 x: 21.81599998474121 y:-3.6710000038146973 z:15.54800033569336
        - atom: N1 x: 20.833999633789062 y:-1.628999948501587 z:15.395999908447266
        - atom: C2 x: 19.836000442504883 y:-0.7789999842643738 z:14.994000434875488
        - atom: N2 x: 19.996999740600586 y:0.5090000033378601 z:15.331999778747559
        - atom: N3 x: 18.766000747680664 y:-1.1640000343322754 z:14.309000015258789
        - atom: C4 x: 18.785999298095703 y:-2.489000082015991 z:14.050000190734863
      - residue DG has 22 atoms
        - atom: P x: 14.321999549865723 y:-1.5820000171661377 z:9.281999588012695
        - atom: OP1 x: 13.01200008392334 y:-0.9649999737739563 z:8.95199966430664
        - atom: OP2 x: 14.77400016784668 y:-2.7820000648498535 z:8.529999732971191
        - atom: O5' x: 15.46500015258789 y:-0.47600001096725464 z:9.168999671936035
        - atom: C5' x: 15.302000045776367 y:0.796999990940094 z:9.78600025177002
        - atom: C4' x: 16.645999908447266 y:1.4179999828338623 z:10.090999603271484
        - atom: O4' x: 17.479999542236328 y:0.46399998664855957 z:10.789999961853027
        - atom: C3' x: 17.46299934387207 y:1.8680000305175781 z:8.876999855041504
        - atom: O3' x: 18.23699951171875 y:3.005000114440918 z:9.279000282287598
        - atom: C2' x: 18.448999404907227 y:0.7289999723434448 z:8.701000213623047
        - atom: C1' x: 18.743999481201172 y:0.4269999861717224 z:10.154000282287598
        - atom: N9 x: 19.35700035095215 y:-0.8669999837875366 z:10.437000274658203
        - atom: C8 x: 18.961999893188477 y:-2.0980000495910645 z:9.970000267028809
        - atom: N7 x: 19.707000732421875 y:-3.0769999027252197 z:10.41100025177002
        - atom: C5 x: 20.650999069213867 y:-2.4560000896453857 z:11.215999603271484
        - atom: C6 x: 21.711999893188477 y:-3.006999969482422 z:11.972000122070312
        - atom: O6 x: 22.041000366210938 y:-4.203999996185303 z:12.086999893188477
        - atom: N1 x: 22.422000885009766 y:-2.015000104904175 z:12.651000022888184
        - atom: C2 x: 22.142000198364258 y:-0.6679999828338623 z:12.607999801635742
        - atom: N2 x: 22.93899917602539 y:0.13600000739097595 z:13.335000038146973
        - atom: N3 x: 21.152999877929688 y:-0.1459999978542328 z:11.904999732971191
        - atom: C4 x: 20.45199966430664 y:-1.090000033378601 z:11.239999771118164
      - residue HOH has 1 atoms
        - atom: O x: 18.135000228881836 y:3.9839999675750732 z:12.008999824523926
      - residue HOH has 1 atoms
        - atom: O x: 13.862000465393066 y:-5.619999885559082 z:23.08300018310547
      - residue HOH has 1 atoms
        - atom: O x: 21.132999420166016 y:-7.02400016784668 z:13.020999908447266
      - residue HOH has 1 atoms
        - atom: O x: 24.173999786376953 y:-5.079999923706055 z:33.534000396728516
 - chain  <Chain id=A> has 427 residues
      - residue THR has 7 atoms
        - atom: N x: 3.50600004196167 y:-24.027999877929688 z:29.959999084472656
        - atom: CA x: 4.690999984741211 y:-23.68400001525879 z:30.798999786376953
        - atom: C x: 5.771999835968018 y:-24.729000091552734 z:30.599000930786133
        - atom: O x: 6.264999866485596 y:-25.347000122070312 z:31.542999267578125
        - atom: CB x: 4.321000099182129 y:-23.61400032043457 z:32.292999267578125
        - atom: OG1 x: 4.0879998207092285 y:-24.940000534057617 z:32.81100082397461
        - atom: CG2 x: 3.069000005722046 y:-22.75 z:32.46699905395508
      - residue LEU has 8 atoms
        - atom: N x: 6.114999771118164 y:-24.933000564575195 z:29.336999893188477
        - atom: CA x: 7.14900016784668 y:-25.878000259399414 z:28.98900032043457
        - atom: C x: 8.472999572753906 y:-25.23200035095215 z:29.381999969482422
        - atom: O x: 9.387999534606934 y:-25.909000396728516 z:29.861000061035156
        - atom: CB x: 7.109000205993652 y:-26.163999557495117 z:27.488000869750977
        - atom: CG x: 5.886000156402588 y:-26.91900062561035 z:26.95199966430664
        - atom: CD1 x: 6.002999782562256 y:-27.079999923706055 z:25.44099998474121
        - atom: CD2 x: 5.789999961853027 y:-28.275999069213867 z:27.613000869750977
      - residue ASN has 8 atoms
        - atom: N x: 8.552000045776367 y:-23.913999557495117 z:29.201000213623047
        - atom: CA x: 9.74899959564209 y:-23.145999908447266 z:29.527999877929688
        - atom: C x: 9.545999526977539 y:-22.253000259399414 z:30.756999969482422
        - atom: O x: 10.102999687194824 y:-21.159000396728516 z:30.836000442504883
        - atom: CB x: 10.137999534606934 y:-22.27899932861328 z:28.33799934387207
        - atom: CG x: 10.458000183105469 y:-23.090999603271484 z:27.111000061035156
        - atom: OD1 x: 11.486000061035156 y:-23.759000778198242 z:27.051000595092773
        - atom: ND2 x: 9.572999954223633 y:-23.04400062561035 z:26.121000289916992
      - residue GLY has 4 atoms
        - atom: N x: 8.763999938964844 y:-22.740999221801758 z:31.716999053955078
        - atom: CA x: 8.47599983215332 y:-21.97800064086914 z:32.922000885009766
        - atom: C x: 9.657999992370605 y:-21.47800064086914 z:33.73500061035156
        - atom: O x: 9.645999908447266 y:-20.341999053955078 z:34.20500183105469
      - residue GLY has 4 atoms
        - atom: N x: 10.67199993133545 y:-22.316999435424805 z:33.91999816894531
        - atom: CA x: 11.829999923706055 y:-21.899999618530273 z:34.689998626708984
        - atom: C x: 12.550999641418457 y:-20.709999084472656 z:34.073001861572266
        - atom: O x: 13.067000389099121 y:-19.834999084472656 z:34.7869987487793
      - residue ILE has 8 atoms
        - atom: N x: 12.583999633789062 y:-20.67799949645996 z:32.74399948120117
        - atom: CA x: 13.246000289916992 y:-19.611000061035156 z:32.01900100708008
        - atom: C x: 12.480999946594238 y:-18.308000564575195 z:32.0890007019043
        - atom: O x: 13.067999839782715 y:-17.257999420166016 z:32.32899856567383
        - atom: CB x: 13.434000015258789 y:-19.965999603271484 z:30.530000686645508
        - atom: CG1 x: 14.45300006866455 y:-21.104000091552734 z:30.38800048828125
        - atom: CG2 x: 13.859999656677246 y:-18.719999313354492 z:29.7450008392334
        - atom: CD1 x: 14.708000183105469 y:-21.54400062561035 z:28.957000732421875
      - residue THR has 7 atoms
        - atom: N x: 11.17199993133545 y:-18.36400032043457 z:31.886999130249023
        - atom: CA x: 10.392000198364258 y:-17.139999389648438 z:31.91200065612793
        - atom: C x: 10.234000205993652 y:-16.545000076293945 z:33.3129997253418
        - atom: O x: 9.973999977111816 y:-15.357000350952148 z:33.44300079345703
        - atom: CB x: 9.015999794006348 y:-17.327999114990234 z:31.190000534057617
        - atom: OG1 x: 8.112000465393066 y:-18.10099983215332 z:31.989999771118164
        - atom: CG2 x: 9.234999656677246 y:-18.034000396728516 z:29.868000030517578
      - residue ASP has 8 atoms
        - atom: N x: 10.395000457763672 y:-17.35700035095215 z:34.356998443603516
        - atom: CA x: 10.33899974822998 y:-16.850000381469727 z:35.73699951171875
        - atom: C x: 11.638999938964844 y:-16.07200050354004 z:35.959999084472656
        - atom: O x: 11.659000396728516 y:-14.982999801635742 z:36.53799819946289
        - atom: CB x: 10.298999786376953 y:-17.98699951171875 z:36.75400161743164
        - atom: CG x: 8.946999549865723 y:-18.631000518798828 z:36.85300064086914
        - atom: OD1 x: 7.943999767303467 y:-17.89299964904785 z:36.93299865722656
        - atom: OD2 x: 8.88599967956543 y:-19.878000259399414 z:36.87099838256836
      - residue MET has 8 atoms
        - atom: N x: 12.729999542236328 y:-16.667999267578125 z:35.49599838256836
        - atom: CA x: 14.029999732971191 y:-16.049999237060547 z:35.595001220703125
        - atom: C x: 13.96500015258789 y:-14.680999755859375 z:34.904998779296875
        - atom: O x: 14.3149995803833 y:-13.659000396728516 z:35.48699951171875
        - atom: CB x: 15.060999870300293 y:-16.926000595092773 z:34.89899826049805
        - atom: CG x: 16.468000411987305 y:-16.416000366210938 z:35.000999450683594
        - atom: SD x: 17.45599937438965 y:-17.030000686645508 z:33.643001556396484
        - atom: CE x: 18.0049991607666 y:-15.479999542236328 z:32.88600158691406
      - residue LEU has 8 atoms
        - atom: N x: 13.51099967956543 y:-14.67199993133545 z:33.659000396728516
        - atom: CA x: 13.411999702453613 y:-13.447999954223633 z:32.88999938964844
        - atom: C x: 12.569999694824219 y:-12.394000053405762 z:33.59400177001953
        - atom: O x: 12.833000183105469 y:-11.189000129699707 z:33.472999572753906
        - atom: CB x: 12.795000076293945 y:-13.741000175476074 z:31.5310001373291
        - atom: CG x: 13.562000274658203 y:-14.668999671936035 z:30.604000091552734
        - atom: CD1 x: 12.758000373840332 y:-14.875 z:29.336999893188477
        - atom: CD2 x: 14.91100025177002 y:-14.074000358581543 z:30.27899932861328
      - residue THR has 7 atoms
        - atom: N x: 11.553000450134277 y:-12.848999977111816 z:34.323001861572266
        - atom: CA x: 10.657999992370605 y:-11.9399995803833 z:35.02000045776367
        - atom: C x: 11.28600025177002 y:-11.27299976348877 z:36.21799850463867
        - atom: O x: 11.097000122070312 y:-10.074999809265137 z:36.4109992980957
        - atom: CB x: 9.369000434875488 y:-12.640999794006348 z:35.45600128173828
        - atom: OG1 x: 8.581999778747559 y:-12.916000366210938 z:34.29399871826172
        - atom: CG2 x: 8.564000129699707 y:-11.765999794006348 z:36.387001037597656
      - residue GLU has 9 atoms
        - atom: N x: 12.020999908447266 y:-12.038000106811523 z:37.02199935913086
        - atom: CA x: 12.682999610900879 y:-11.47599983215332 z:38.189998626708984
        - atom: C x: 13.690999984741211 y:-10.45199966430664 z:37.67300033569336
        - atom: O x: 13.807000160217285 y:-9.345000267028809 z:38.196998596191406
        - atom: CB x: 13.37399959564209 y:-12.588000297546387 z:38.98899841308594
        - atom: CG x: 14.23799991607666 y:-12.11400032043457 z:40.15599822998047
        - atom: CD x: 14.40999984741211 y:-13.187000274658203 z:41.233001708984375
        - atom: OE1 x: 14.732999801635742 y:-14.33899974822998 z:40.88600158691406
        - atom: OE2 x: 14.22599983215332 y:-12.878000259399414 z:42.43600082397461
      - residue LEU has 8 atoms
        - atom: N x: 14.407999992370605 y:-10.817999839782715 z:36.62200164794922
        - atom: CA x: 15.376999855041504 y:-9.906000137329102 z:36.029998779296875
        - atom: C x: 14.710000038146973 y:-8.588000297546387 z:35.63999938964844
        - atom: O x: 15.276000022888184 y:-7.519999980926514 z:35.840999603271484
        - atom: CB x: 16.006000518798828 y:-10.550999641418457 z:34.801998138427734
        - atom: CG x: 17.10099983215332 y:-11.543000221252441 z:35.15599822998047
        - atom: CD1 x: 17.541000366210938 y:-12.317999839782715 z:33.928001403808594
        - atom: CD2 x: 18.26300048828125 y:-10.758000373840332 z:35.744998931884766
      - residue ALA has 5 atoms
        - atom: N x: 13.50100040435791 y:-8.6850004196167 z:35.09000015258789
        - atom: CA x: 12.727999687194824 y:-7.525000095367432 z:34.66899871826172
        - atom: C x: 12.454999923706055 y:-6.618000030517578 z:35.85900115966797
        - atom: O x: 12.86400032043457 y:-5.453999996185303 z:35.887001037597656
        - atom: CB x: 11.416000366210938 y:-7.9730000495910645 z:34.04499816894531
      - residue ASN has 8 atoms
        - atom: N x: 11.75100040435791 y:-7.1519999504089355 z:36.84299850463867
        - atom: CA x: 11.447999954223633 y:-6.377999782562256 z:38.02799987792969
        - atom: C x: 12.694999694824219 y:-5.685999870300293 z:38.54800033569336
        - atom: O x: 12.654999732971191 y:-4.507999897003174 z:38.917999267578125
        - atom: CB x: 10.857000350952148 y:-7.275000095367432 z:39.09700012207031
        - atom: CG x: 9.361000061035156 y:-7.355999946594238 z:38.999000549316406
        - atom: OD1 x: 8.668000221252441 y:-6.34499979019165 z:39.154998779296875
        - atom: ND2 x: 8.843999862670898 y:-8.548999786376953 z:38.73500061035156
      - residue PHE has 11 atoms
        - atom: N x: 13.807000160217285 y:-6.414000034332275 z:38.56399917602539
        - atom: CA x: 15.053000450134277 y:-5.831999778747559 z:39.0260009765625
        - atom: C x: 15.369000434875488 y:-4.565999984741211 z:38.233001708984375
        - atom: O x: 15.411999702453613 y:-3.4700000286102295 z:38.79100036621094
        - atom: CB x: 16.20800018310547 y:-6.817999839782715 z:38.86600112915039
        - atom: CG x: 17.55500030517578 y:-6.203999996185303 z:39.13100051879883
        - atom: CD1 x: 18.569000244140625 y:-6.275000095367432 z:38.180999755859375
        - atom: CD2 x: 17.791000366210938 y:-5.498000144958496 z:40.30799865722656
        - atom: CE1 x: 19.79800033569336 y:-5.644000053405762 z:38.39899826049805
        - atom: CE2 x: 19.00200080871582 y:-4.873000144958496 z:40.52799987792969
        - atom: CZ x: 20.007999420166016 y:-4.941999912261963 z:39.57600021362305
      - residue GLU has 9 atoms
        - atom: N x: 15.581000328063965 y:-4.728000164031982 z:36.926998138427734
        - atom: CA x: 15.913999557495117 y:-3.611999988555908 z:36.04999923706055
        - atom: C x: 14.92199993133545 y:-2.4560000896453857 z:36.1609992980957
        - atom: O x: 15.28499984741211 y:-1.3009999990463257 z:35.96900177001953
        - atom: CB x: 16.007999420166016 y:-4.086999893188477 z:34.59299850463867
        - atom: CG x: 17.152000427246094 y:-5.060999870300293 z:34.27799987792969
        - atom: CD x: 18.538000106811523 y:-4.489999771118164 z:34.58700180053711
        - atom: OE1 x: 18.69700050354004 y:-3.260999917984009 z:34.5260009765625
        - atom: OE2 x: 19.479000091552734 y:-5.265999794006348 z:34.875
      - residue LYS has 9 atoms
        - atom: N x: 13.677000045776367 y:-2.7669999599456787 z:36.48400115966797
        - atom: CA x: 12.642999649047852 y:-1.753000020980835 z:36.61600112915039
        - atom: C x: 12.543999671936035 y:-1.121999979019165 z:37.99599838256836
        - atom: O x: 12.244000434875488 y:0.06400000303983688 z:38.12799835205078
        - atom: CB x: 11.277999877929688 y:-2.3440001010894775 z:36.2859992980957
        - atom: CG x: 10.192999839782715 y:-1.8370000123977661 z:37.207000732421875
        - atom: CD x: 8.888999938964844 y:-1.6490000486373901 z:36.49800109863281
        - atom: CE x: 8.100000381469727 y:-0.546999990940094 z:37.20000076293945
        - atom: NZ x: 8.9350004196167 y:0.6930000185966492 z:37.34199905395508
      - residue ASN has 8 atoms
        - atom: N x: 12.75100040435791 y:-1.9199999570846558 z:39.03200149536133
        - atom: CA x: 12.637999534606934 y:-1.3869999647140503 z:40.36899948120117
        - atom: C x: 13.968000411987305 y:-0.8429999947547913 z:40.900001525878906
        - atom: O x: 14.02299976348877 y:0.24799999594688416 z:41.45899963378906
        - atom: CB x: 12.067999839782715 y:-2.4579999446868896 z:41.319000244140625
        - atom: CG x: 10.592000007629395 y:-2.7790000438690186 z:41.04800033569336
        - atom: OD1 x: 9.795999526977539 y:-1.8949999809265137 z:40.73699951171875
        - atom: ND2 x: 10.22700023651123 y:-4.045000076293945 z:41.18899917602539
      - residue VAL has 7 atoms
        - atom: N x: 15.041999816894531 y:-1.590999960899353 z:40.698001861572266
        - atom: CA x: 16.341999053955078 y:-1.1859999895095825 z:41.19900131225586
        - atom: C x: 17.093000411987305 y:-0.3190000057220459 z:40.21500015258789
        - atom: O x: 17.384000778198242 y:0.828000009059906 z:40.51300048828125
        - atom: CB x: 17.204999923706055 y:-2.4189999103546143 z:41.53900146484375
        - atom: CG1 x: 18.464000701904297 y:-1.99399995803833 z:42.32699966430664
        - atom: CG2 x: 16.385000228881836 y:-3.4179999828338623 z:42.33000183105469
      - residue SER has 6 atoms
        - atom: N x: 17.406999588012695 y:-0.871999979019165 z:39.04600143432617
        - atom: CA x: 18.14699935913086 y:-0.14800000190734863 z:37.999000549316406
        - atom: C x: 17.43199920654297 y:1.0440000295639038 z:37.369998931884766
        - atom: O x: 18.065000534057617 y:1.8589999675750732 z:36.69300079345703
        - atom: CB x: 18.55500030517578 y:-1.0989999771118164 z:36.875
        - atom: OG x: 19.535999298095703 y:-2.0239999294281006 z:37.31100082397461
      - residue GLN has 9 atoms
        - atom: N x: 16.125 y:1.1460000276565552 z:37.58000183105469
        - atom: CA x: 15.355999946594238 y:2.244999885559082 z:37.012001037597656
        - atom: C x: 15.548999786376953 y:2.385999917984009 z:35.499000549316406
        - atom: O x: 15.527999877929688 y:3.4839999675750732 z:34.96200180053711
        - atom: CB x: 15.715999603271484 y:3.553999900817871 z:37.7140007019043
        - atom: CG x: 15.02299976348877 y:3.7219998836517334 z:39.07899856567383
        - atom: CD x: 15.668000221252441 y:4.795000076293945 z:39.96500015258789
        - atom: OE1 x: 16.8799991607666 y:4.752999782562256 z:40.2400016784668
        - atom: NE2 x: 14.861000061035156 y:5.743000030517578 z:40.42499923706055
      - residue ALA has 5 atoms
        - atom: N x: 15.746000289916992 y:1.2569999694824219 z:34.82899856567383
        - atom: CA x: 15.914999961853027 y:1.1920000314712524 z:33.37699890136719
        - atom: C x: 14.652999877929688 y:0.49300000071525574 z:32.85499954223633
        - atom: O x: 14.583000183105469 y:-0.7369999885559082 z:32.79999923706055
        - atom: CB x: 17.15399932861328 y:0.3790000081062317 z:33.03300094604492
      - residue ILE has 8 atoms
        - atom: N x: 13.656999588012695 y:1.2949999570846558 z:32.49599838256836
        - atom: CA x: 12.378000259399414 y:0.7940000295639038 z:32.0260009765625
        - atom: C x: 12.460000038146973 y:0.032999999821186066 z:30.702999114990234
        - atom: O x: 11.57699966430664 y:-0.7519999742507935 z:30.37299919128418
        - atom: CB x: 11.407999992370605 y:1.9550000429153442 z:31.85700035095215
        - atom: CG1 x: 10.034000396728516 y:1.4700000286102295 z:31.36199951171875
        - atom: CG2 x: 12.008999824523926 y:2.937000036239624 z:30.867000579833984
        - atom: CD1 x: 9.13700008392334 y:0.8830000162124634 z:32.4379997253418
      - residue HIS has 10 atoms
        - atom: N x: 13.517000198364258 y:0.2529999911785126 z:29.94099998474121
        - atom: CA x: 13.626999855041504 y:-0.42500001192092896 z:28.665000915527344
        - atom: C x: 14.244000434875488 y:-1.7960000038146973 z:28.760000228881836
        - atom: O x: 14.008999824523926 y:-2.6500000953674316 z:27.905000686645508
        - atom: CB x: 14.366999626159668 y:0.4620000123977661 z:27.674999237060547
        - atom: CG x: 13.645999908447266 y:1.7430000305175781 z:27.393999099731445
        - atom: ND1 x: 12.3100004196167 y:1.7760000228881836 z:27.051000595092773
        - atom: CD2 x: 14.04800033569336 y:3.0329999923706055 z:27.476999282836914
        - atom: CE1 x: 11.918999671936035 y:3.0320000648498535 z:26.941999435424805
        - atom: NE2 x: 12.954000473022461 y:3.813999891281128 z:27.19499969482422
      - residue LYS has 9 atoms
        - atom: N x: 15.031999588012695 y:-2.0220000743865967 z:29.798999786376953
        - atom: CA x: 15.621000289916992 y:-3.3359999656677246 z:29.981000900268555
        - atom: C x: 14.463000297546387 y:-4.136000156402588 z:30.52199935913086
        - atom: O x: 14.262999534606934 y:-5.2829999923706055 z:30.141000747680664
        - atom: CB x: 16.773000717163086 y:-3.299999952316284 z:30.996000289916992
        - atom: CG x: 17.975000381469727 y:-2.4779999256134033 z:30.540000915527344
        - atom: CD x: 19.246000289916992 y:-2.9200000762939453 z:31.253000259399414
        - atom: CE x: 20.474000930786133 y:-2.2990000247955322 z:30.60099983215332
        - atom: NZ x: 21.74799919128418 y:-2.9100000858306885 z:31.034000396728516
      - residue TYR has 12 atoms
        - atom: N x: 13.689000129699707 y:-3.5139999389648438 z:31.408000946044922
        - atom: CA x: 12.527999877929688 y:-4.175000190734863 z:31.989999771118164
        - atom: C x: 11.668999671936035 y:-4.672999858856201 z:30.836999893188477
        - atom: O x: 11.380999565124512 y:-5.86899995803833 z:30.731000900268555
        - atom: CB x: 11.722999572753906 y:-3.194999933242798 z:32.847999572753906
        - atom: CG x: 10.309000015258789 y:-3.6470000743865967 z:33.15999984741211
        - atom: CD1 x: 10.064000129699707 y:-4.732999801635742 z:33.992000579833984
        - atom: CD2 x: 9.215999603271484 y:-2.9639999866485596 z:32.64899826049805
        - atom: CE1 x: 8.758999824523926 y:-5.125 z:34.310001373291016
        - atom: CE2 x: 7.9070000648498535 y:-3.3469998836517334 z:32.96200180053711
        - atom: CZ x: 7.689000129699707 y:-4.423999786376953 z:33.79100036621094
        - atom: OH x: 6.39900016784668 y:-4.795000076293945 z:34.09600067138672
      - residue ASN has 8 atoms
        - atom: N x: 11.267000198364258 y:-3.75 z:29.965999603271484
        - atom: CA x: 10.454999923706055 y:-4.125 z:28.819000244140625
        - atom: C x: 11.135000228881836 y:-5.242000102996826 z:28.03499984741211
        - atom: O x: 10.5 y:-6.247000217437744 z:27.711999893188477
        - atom: CB x: 10.20300006866455 y:-2.9200000762939453 z:27.91200065612793
        - atom: CG x: 9.14900016784668 y:-2.003999948501587 z:28.468000411987305
        - atom: OD1 x: 8.194000244140625 y:-2.4619998931884766 z:29.083999633789062
        - atom: ND2 x: 9.305000305175781 y:-0.7049999833106995 z:28.249000549316406
      - residue ALA has 5 atoms
        - atom: N x: 12.42199993133545 y:-5.059999942779541 z:27.74799919128418
        - atom: CA x: 13.201000213623047 y:-6.046000003814697 z:27.020999908447266
        - atom: C x: 13.07800006866455 y:-7.461999893188477 z:27.60099983215332
        - atom: O x: 12.82699966430664 y:-8.409000396728516 z:26.867000579833984
        - atom: CB x: 14.645999908447266 y:-5.619999885559082 z:26.993999481201172
      - residue TYR has 12 atoms
        - atom: N x: 13.26200008392334 y:-7.61299991607666 z:28.910999298095703
        - atom: CA x: 13.152000427246094 y:-8.927000045776367 z:29.538000106811523
        - atom: C x: 11.708000183105469 y:-9.369000434875488 z:29.48699951171875
        - atom: O x: 11.395999908447266 y:-10.520000457763672 z:29.2189998626709
        - atom: CB x: 13.609999656677246 y:-8.871000289916992 z:31.00200080871582
        - atom: CG x: 15.104999542236328 y:-8.961999893188477 z:31.177000045776367
        - atom: CD1 x: 15.8100004196167 y:-10.065999984741211 z:30.708999633789062
        - atom: CD2 x: 15.821000099182129 y:-7.946000099182129 z:31.804000854492188
        - atom: CE1 x: 17.191999435424805 y:-10.159000396728516 z:30.85700035095215
        - atom: CE2 x: 17.207000732421875 y:-8.029999732971191 z:31.95599937438965
        - atom: CZ x: 17.881999969482422 y:-9.13700008392334 z:31.481000900268555
        - atom: OH x: 19.249000549316406 y:-9.23799991607666 z:31.62700080871582
      - residue ARG has 11 atoms
        - atom: N x: 10.82800006866455 y:-8.425999641418457 z:29.774999618530273
        - atom: CA x: 9.402000427246094 y:-8.663000106811523 z:29.78499984741211
        - atom: C x: 8.987000465393066 y:-9.234000205993652 z:28.422000885009766
        - atom: O x: 8.211000442504883 y:-10.1850004196167 z:28.336999893188477
        - atom: CB x: 8.715999603271484 y:-7.334000110626221 z:30.06999969482422
        - atom: CG x: 7.258999824523926 y:-7.432000160217285 z:30.378000259399414
        - atom: CD x: 7.006999969482422 y:-7.331999778747559 z:31.860000610351562
        - atom: NE x: 5.626999855041504 y:-6.922999858856201 z:32.09299850463867
        - atom: CZ x: 5.074999809265137 y:-5.839000225067139 z:31.549999237060547
        - atom: NH1 x: 5.791999816894531 y:-5.061999797821045 z:30.73699951171875
        - atom: NH2 x: 3.812000036239624 y:-5.519999980926514 z:31.82900047302246
      - residue LYS has 9 atoms
        - atom: N x: 9.53499984741211 y:-8.657999992370605 z:27.354999542236328
        - atom: CA x: 9.25 y:-9.10099983215332 z:25.996000289916992
        - atom: C x: 9.82699966430664 y:-10.49899959564209 z:25.763999938964844
        - atom: O x: 9.098999977111816 y:-11.430000305175781 z:25.424999237060547
        - atom: CB x: 9.835000038146973 y:-8.100000381469727 z:24.999000549316406
        - atom: CG x: 9.510000228881836 y:-8.36299991607666 z:23.541000366210938
        - atom: CD x: 9.970000267028809 y:-7.190000057220459 z:22.68400001525879
        - atom: CE x: 10.038000106811523 y:-7.559000015258789 z:21.20800018310547
        - atom: NZ x: 10.956999778747559 y:-8.722000122070312 z:20.97100067138672
      - residue ALA has 5 atoms
        - atom: N x: 11.128999710083008 y:-10.652999877929688 z:25.959999084472656
        - atom: CA x: 11.76200008392334 y:-11.949000358581543 z:25.777999877929688
        - atom: C x: 10.984999656677246 y:-13.067000389099121 z:26.46299934387207
        - atom: O x: 10.824000358581543 y:-14.14799976348877 z:25.902999877929688
        - atom: CB x: 13.173999786376953 y:-11.914999961853027 z:26.304000854492188
      - residue ALA has 5 atoms
        - atom: N x: 10.5 y:-12.812000274658203 z:27.672000885009766
        - atom: CA x: 9.753999710083008 y:-13.829999923706055 z:28.402000427246094
        - atom: C x: 8.461000442504883 y:-14.230999946594238 z:27.68199920654297
        - atom: O x: 8.182000160217285 y:-15.414999961853027 z:27.506999969482422
        - atom: CB x: 9.442999839782715 y:-13.34000015258789 z:29.815000534057617
      - residue SER has 6 atoms
        - atom: N x: 7.676000118255615 y:-13.246000289916992 z:27.266000747680664
        - atom: CA x: 6.428999900817871 y:-13.508999824523926 z:26.575000762939453
        - atom: C x: 6.638999938964844 y:-14.333000183105469 z:25.29599952697754
        - atom: O x: 5.808000087738037 y:-15.168999671936035 z:24.929000854492188
        - atom: CB x: 5.763000011444092 y:-12.182000160217285 z:26.229999542236328
        - atom: OG x: 4.60099983215332 y:-12.369999885559082 z:25.44099998474121
      - residue VAL has 7 atoms
        - atom: N x: 7.751999855041504 y:-14.08899974822998 z:24.615999221801758
        - atom: CA x: 8.069000244140625 y:-14.795999526977539 z:23.388999938964844
        - atom: C x: 8.357000350952148 y:-16.267000198364258 z:23.677000045776367
        - atom: O x: 7.839000225067139 y:-17.152999877929688 z:22.985000610351562
        - atom: CB x: 9.284000396728516 y:-14.144000053405762 z:22.694000244140625
        - atom: CG1 x: 10.064000129699707 y:-15.180999755859375 z:21.92300033569336
        - atom: CG2 x: 8.812999725341797 y:-13.031000137329102 z:21.76099967956543
      - residue ILE has 8 atoms
        - atom: N x: 9.189000129699707 y:-16.523000717163086 z:24.68899917602539
        - atom: CA x: 9.541000366210938 y:-17.88800048828125 z:25.08799934387207
        - atom: C x: 8.321999549865723 y:-18.58099937438965 z:25.70199966430664
        - atom: O x: 8.041000366210938 y:-19.75 z:25.413000106811523
        - atom: CB x: 10.6850004196167 y:-17.89900016784668 z:26.131999969482422
        - atom: CG1 x: 12.006999969482422 y:-17.5049991607666 z:25.482999801635742
        - atom: CG2 x: 10.8100004196167 y:-19.267000198364258 z:26.743000030517578
        - atom: CD1 x: 13.130999565124512 y:-17.316999435424805 z:26.476999282836914
      - residue ALA has 5 atoms
        - atom: N x: 7.605999946594238 y:-17.854999542236328 z:26.55299949645996
        - atom: CA x: 6.414000034332275 y:-18.388999938964844 z:27.195999145507812
        - atom: C x: 5.311999797821045 y:-18.68000030517578 z:26.170000076293945
        - atom: O x: 4.185999870300293 y:-19.033000946044922 z:26.5310001373291
        - atom: CB x: 5.906000137329102 y:-17.415000915527344 z:28.23200035095215
      - residue LYS has 9 atoms
        - atom: N x: 5.626999855041504 y:-18.524999618530273 z:24.888999938964844
        - atom: CA x: 4.650000095367432 y:-18.802000045776367 z:23.851999282836914
        - atom: C x: 5.250999927520752 y:-19.749000549316406 z:22.81100082397461
        - atom: O x: 4.5879998207092285 y:-20.131999969482422 z:21.847999572753906
        - atom: CB x: 4.186999797821045 y:-17.496999740600586 z:23.204999923706055
        - atom: CG x: 2.924999952316284 y:-17.617000579833984 z:22.378999710083008
        - atom: CD x: 2.450000047683716 y:-16.24799919128418 z:21.92099952697754
        - atom: CE x: 3.4739999771118164 y:-15.571999549865723 z:21.01799964904785
        - atom: NZ x: 3.049999952316284 y:-14.184000015258789 z:20.684999465942383
      - residue TYR has 12 atoms
        - atom: N x: 6.513000011444092 y:-20.1200008392334 z:23.009000778198242
        - atom: CA x: 7.193999767303467 y:-21.051000595092773 z:22.108999252319336
        - atom: C x: 6.574999809265137 y:-22.388999938964844 z:22.45599937438965
        - atom: O x: 6.429999828338623 y:-22.719999313354492 z:23.631000518798828
        - atom: CB x: 8.675000190734863 y:-21.06599998474121 z:22.42099952697754
        - atom: CG x: 9.553000450134277 y:-21.915000915527344 z:21.53700065612793
        - atom: CD1 x: 9.6850004196167 y:-21.6560001373291 z:20.166000366210938
        - atom: CD2 x: 10.39799976348877 y:-22.868000030517578 z:22.111000061035156
        - atom: CE1 x: 10.666999816894531 y:-22.320999145507812 z:19.39699935913086
        - atom: CE2 x: 11.368000030517578 y:-23.527999877929688 z:21.361000061035156
        - atom: CZ x: 11.506999969482422 y:-23.253999710083008 z:20.016000747680664
        - atom: OH x: 12.527999877929688 y:-23.892000198364258 z:19.347999572753906
      - residue PRO has 7 atoms
        - atom: N x: 6.186999797821045 y:-23.167999267578125 z:21.437999725341797
        - atom: CA x: 5.563000202178955 y:-24.483999252319336 z:21.61400032043457
        - atom: C x: 6.4720001220703125 y:-25.672000885009766 z:21.94700050354004
        - atom: O x: 5.98199987411499 y:-26.764999389648438 z:22.20800018310547
        - atom: CB x: 4.800000190734863 y:-24.670000076293945 z:20.30299949645996
        - atom: CG x: 5.709000110626221 y:-24.02400016784668 z:19.30900001525879
        - atom: CD x: 6.133999824523926 y:-22.7450008392334 z:20.025999069213867
      - residue HIS has 10 atoms
        - atom: N x: 7.7820000648498535 y:-25.472000122070312 z:21.944000244140625
        - atom: CA x: 8.687000274658203 y:-26.566999435424805 z:22.27199935913086
        - atom: C x: 9.373000144958496 y:-26.291000366210938 z:23.597000122070312
        - atom: O x: 9.204000473022461 y:-25.219999313354492 z:24.173999786376953
        - atom: CB x: 9.75100040435791 y:-26.72800064086914 z:21.19099998474121
        - atom: CG x: 9.192999839782715 y:-26.843000411987305 z:19.81100082397461
        - atom: ND1 x: 8.234000205993652 y:-27.770999908447266 z:19.472000122070312
        - atom: CD2 x: 9.461999893188477 y:-26.148000717163086 z:18.680999755859375
        - atom: CE1 x: 7.934999942779541 y:-27.64299964904785 z:18.191999435424805
        - atom: NE2 x: 8.666000366210938 y:-26.665000915527344 z:17.687999725341797
      - residue LYS has 9 atoms
        - atom: N x: 10.135000228881836 y:-27.26099967956543 z:24.09000015258789
        - atom: CA x: 10.866999626159668 y:-27.077999114990234 z:25.336000442504883
        - atom: C x: 12.291999816894531 y:-26.701000213623047 z:24.979000091552734
        - atom: O x: 13.027999877929688 y:-27.5 z:24.395999908447266
        - atom: CB x: 10.859999656677246 y:-28.347000122070312 z:26.18000030517578
        - atom: CG x: 12.022000312805176 y:-28.41900062561035 z:27.149999618530273
        - atom: CD x: 11.635000228881836 y:-29.1200008392334 z:28.43199920654297
        - atom: CE x: 10.968999862670898 y:-28.14699935913086 z:29.37700080871582
        - atom: NZ x: 11.902000427246094 y:-27.017000198364258 z:29.71500015258789
      - residue ILE has 8 atoms
        - atom: N x: 12.661999702453613 y:-25.47100067138672 z:25.326000213623047
        - atom: CA x: 13.979999542236328 y:-24.924999237060547 z:25.03700065612793
        - atom: C x: 15.112000465393066 y:-25.763999938964844 z:25.604999542236328
        - atom: O x: 15.272000312805176 y:-25.878999710083008 z:26.81800079345703
        - atom: CB x: 14.07800006866455 y:-23.479999542236328 z:25.554000854492188
        - atom: CG1 x: 13.07699966430664 y:-22.618000030517578 z:24.783000946044922
        - atom: CG2 x: 15.498000144958496 y:-22.948999404907227 z:25.399999618530273
        - atom: CD1 x: 13.050000190734863 y:-21.170000076293945 z:25.19499969482422
      - residue LYS has 9 atoms
        - atom: N x: 15.897000312805176 y:-26.341999053955078 z:24.70400047302246
        - atom: CA x: 17.009000778198242 y:-27.194000244140625 z:25.08300018310547
        - atom: C x: 18.363000869750977 y:-26.479000091552734 z:25.097000122070312
        - atom: O x: 19.3799991607666 y:-27.075000762939453 z:25.45400047302246
        - atom: CB x: 17.05900001525879 y:-28.413999557495117 z:24.1560001373291
        - atom: CG x: 15.869000434875488 y:-29.34600067138672 z:24.302000045776367
        - atom: CD x: 16.128000259399414 y:-30.667999267578125 z:23.60300064086914
        - atom: CE x: 15.015000343322754 y:-31.684999465942383 z:23.892000198364258
        - atom: NZ x: 15.324999809265137 y:-33.077999114990234 z:23.42300033569336
      - residue SER has 6 atoms
        - atom: N x: 18.378000259399414 y:-25.202999114990234 z:24.72100067138672
        - atom: CA x: 19.618999481201172 y:-24.429000854492188 z:24.722000122070312
        - atom: C x: 19.31399917602539 y:-22.95199966430664 z:24.527000427246094
        - atom: O x: 18.201000213623047 y:-22.58300018310547 z:24.15399932861328
        - atom: CB x: 20.55699920654297 y:-24.892000198364258 z:23.604000091552734
        - atom: OG x: 20.27899932861328 y:-24.198999404907227 z:22.398000717163086
      - residue GLY has 4 atoms
        - atom: N x: 20.309999465942383 y:-22.110000610351562 z:24.777999877929688
        - atom: CA x: 20.1200008392334 y:-20.68199920654297 z:24.617000579833984
        - atom: C x: 20.091999053955078 y:-20.316999435424805 z:23.14699935913086
        - atom: O x: 19.503999710083008 y:-19.30699920654297 z:22.756000518798828
      - residue ALA has 5 atoms
        - atom: N x: 20.73200035095215 y:-21.145999908447266 z:22.327999114990234
        - atom: CA x: 20.773000717163086 y:-20.899999618530273 z:20.902000427246094
        - atom: C x: 19.391000747680664 y:-21.14299964904785 z:20.302000045776367
        - atom: O x: 18.961999893188477 y:-20.430999755859375 z:19.392000198364258
        - atom: CB x: 21.799999237060547 y:-21.798999786376953 z:20.253000259399414
      - residue GLU has 9 atoms
        - atom: N x: 18.69300079345703 y:-22.150999069213867 z:20.809999465942383
        - atom: CA x: 17.35700035095215 y:-22.451000213623047 z:20.31999969482422
        - atom: C x: 16.514999389648438 y:-21.20599937438965 z:20.593000411987305
        - atom: O x: 15.798999786376953 y:-20.719999313354492 z:19.715999603271484
        - atom: CB x: 16.768999099731445 y:-23.655000686645508 z:21.06100082397461
        - atom: CG x: 15.47700023651123 y:-24.17300033569336 z:20.458999633789062
        - atom: CD x: 14.970999717712402 y:-25.433000564575195 z:21.138999938964844
        - atom: OE1 x: 15.795999526977539 y:-26.31999969482422 z:21.44700050354004
        - atom: OE2 x: 13.744999885559082 y:-25.54800033569336 z:21.347999572753906
      - residue ALA has 5 atoms
        - atom: N x: 16.632999420166016 y:-20.677000045776367 z:21.808000564575195
        - atom: CA x: 15.897000312805176 y:-19.48900032043457 z:22.211000442504883
        - atom: C x: 16.354000091552734 y:-18.23699951171875 z:21.452999114990234
        - atom: O x: 15.574999809265137 y:-17.315000534057617 z:21.225000381469727
        - atom: CB x: 16.05699920654297 y:-19.281999588012695 z:23.701000213623047
      - residue LYS has 9 atoms
        - atom: N x: 17.624000549316406 y:-18.20800018310547 z:21.069000244140625
        - atom: CA x: 18.18400001525879 y:-17.07699966430664 z:20.341999053955078
        - atom: C x: 17.55699920654297 y:-16.8799991607666 z:18.937999725341797
        - atom: O x: 17.700000762939453 y:-15.824000358581543 z:18.320999145507812
        - atom: CB x: 19.695999145507812 y:-17.263999938964844 z:20.235000610351562
        - atom: CG x: 20.41699981689453 y:-16.229000091552734 z:19.392000198364258
        - atom: CD x: 20.399999618530273 y:-14.847999572753906 z:20.023000717163086
        - atom: CE x: 21.18199920654297 y:-13.862000465393066 z:19.165000915527344
        - atom: NZ x: 22.56599998474121 y:-14.347000122070312 z:18.958999633789062
      - residue LYS has 9 atoms
        - atom: N x: 16.861000061035156 y:-17.892000198364258 z:18.434999465942383
        - atom: CA x: 16.226999282836914 y:-17.773000717163086 z:17.131000518798828
        - atom: C x: 15.065999984741211 y:-16.77199935913086 z:17.200000762939453
        - atom: O x: 14.831000328063965 y:-16.006999969482422 z:16.256999969482422
        - atom: CB x: 15.673999786376953 y:-19.125 z:16.680999755859375
        - atom: CG x: 16.683000564575195 y:-20.246999740600586 z:16.594999313354492
        - atom: CD x: 15.987000465393066 y:-21.54400062561035 z:16.172000885009766
        - atom: CE x: 16.908000946044922 y:-22.753999710083008 z:16.27899932861328
        - atom: NZ x: 16.2549991607666 y:-24.025999069213867 z:15.857000350952148
      - residue LEU has 8 atoms
        - atom: N x: 14.343999862670898 y:-16.790000915527344 z:18.32200050354004
        - atom: CA x: 13.184000015258789 y:-15.925999641418457 z:18.53700065612793
        - atom: C x: 13.527999877929688 y:-14.432999610900879 z:18.64699935913086
        - atom: O x: 14.597000122070312 y:-14.064000129699707 z:19.136999130249023
        - atom: CB x: 12.437000274658203 y:-16.3799991607666 z:19.795000076293945
        - atom: CG x: 12.102999687194824 y:-17.868000030517578 z:19.90399932861328
        - atom: CD1 x: 11.484999656677246 y:-18.17799949645996 z:21.260000228881836
        - atom: CD2 x: 11.161999702453613 y:-18.250999450683594 z:18.78499984741211
      - residue PRO has 7 atoms
        - atom: N x: 12.616000175476074 y:-13.555999755859375 z:18.187000274658203
        - atom: CA x: 12.782999992370605 y:-12.100000381469727 z:18.21500015258789
        - atom: C x: 12.5 y:-11.564000129699707 z:19.618000030517578
        - atom: O x: 11.369999885559082 y:-11.609999656677246 z:20.106000900268555
        - atom: CB x: 11.753000259399414 y:-11.631999969482422 z:17.20800018310547
        - atom: CG x: 10.605999946594238 y:-12.545000076293945 z:17.520000457763672
        - atom: CD x: 11.295999526977539 y:-13.909000396728516 z:17.631999969482422
      - residue GLY has 4 atoms
        - atom: N x: 13.532999992370605 y:-11.04699993133545 z:20.26300048828125
        - atom: CA x: 13.359999656677246 y:-10.550000190734863 z:21.61199951171875
        - atom: C x: 14.352999687194824 y:-11.239999771118164 z:22.52199935913086
        - atom: O x: 14.593999862670898 y:-10.791000366210938 z:23.634000778198242
      - residue VAL has 7 atoms
        - atom: N x: 14.920000076293945 y:-12.342000007629395 z:22.047000885009766
        - atom: CA x: 15.909000396728516 y:-13.072999954223633 z:22.801000595092773
        - atom: C x: 17.238000869750977 y:-12.873000144958496 z:22.11199951171875
        - atom: O x: 17.503000259399414 y:-13.482999801635742 z:21.072999954223633
        - atom: CB x: 15.623000144958496 y:-14.553999900817871 z:22.81399917602539
        - atom: CG1 x: 16.7549991607666 y:-15.277000427246094 z:23.52199935913086
        - atom: CG2 x: 14.295000076293945 y:-14.815999984741211 z:23.481000900268555
      - residue GLY has 4 atoms
        - atom: N x: 18.07200050354004 y:-12.015999794006348 z:22.69700050354004
        - atom: CA x: 19.378999710083008 y:-11.729999542236328 z:22.134000778198242
        - atom: C x: 20.488000869750977 y:-12.513999938964844 z:22.802000045776367
        - atom: O x: 20.222000122070312 y:-13.487000465393066 z:23.506000518798828
      - residue THR has 7 atoms
        - atom: N x: 21.72800064086914 y:-12.062999725341797 z:22.60300064086914
        - atom: CA x: 22.920000076293945 y:-12.718999862670898 z:23.145999908447266
        - atom: C x: 22.94099998474121 y:-12.92199993133545 z:24.6560001373291
        - atom: O x: 23.170000076293945 y:-14.029999732971191 z:25.128000259399414
        - atom: CB x: 24.21299934387207 y:-11.954999923706055 z:22.770000457763672
        - atom: OG1 x: 24.249000549316406 y:-11.710000038146973 z:21.356000900268555
        - atom: CG2 x: 25.434999465942383 y:-12.774999618530273 z:23.156999588012695
      - residue LYS has 9 atoms
        - atom: N x: 22.709999084472656 y:-11.857999801635742 z:25.413000106811523
        - atom: CA x: 22.726999282836914 y:-11.961000442504883 z:26.865999221801758
        - atom: C x: 21.701000213623047 y:-12.954000473022461 z:27.388999938964844
        - atom: O x: 22.0 y:-13.739999771118164 z:28.275999069213867
        - atom: CB x: 22.475000381469727 y:-10.595999717712402 z:27.5
        - atom: CG x: 23.288000106811523 y:-9.480999946594238 z:26.8700008392334
        - atom: CD x: 24.777000427246094 y:-9.682999610900879 z:27.093000411987305
        - atom: CE x: 25.266000747680664 y:-8.854999542236328 z:28.26300048828125
        - atom: NZ x: 25.291000366210938 y:-7.4070000648498535 z:27.913999557495117
      - residue ILE has 8 atoms
        - atom: N x: 20.489999771118164 y:-12.942000389099121 z:26.85099983215332
        - atom: CA x: 19.493000030517578 y:-13.871000289916992 z:27.351999282836914
        - atom: C x: 19.766000747680664 y:-15.331000328063965 z:26.969999313354492
        - atom: O x: 19.400999069213867 y:-16.253000259399414 z:27.704999923706055
        - atom: CB x: 18.073999404907227 y:-13.446999549865723 z:26.920000076293945
        - atom: CG1 x: 17.691999435424805 y:-12.152999877929688 z:27.6560001373291
        - atom: CG2 x: 17.062999725341797 y:-14.581000328063965 z:27.211999893188477
        - atom: CD1 x: 16.2549991607666 y:-11.734999656677246 z:27.492000579833984
      - residue ALA has 5 atoms
        - atom: N x: 20.427000045776367 y:-15.54800033569336 z:25.836999893188477
        - atom: CA x: 20.742000579833984 y:-16.9060001373291 z:25.4060001373291
        - atom: C x: 21.82200050354004 y:-17.413000106811523 z:26.351999282836914
        - atom: O x: 21.839000701904297 y:-18.582000732421875 z:26.763999938964844
        - atom: CB x: 21.256999969482422 y:-16.88800048828125 z:23.981000900268555
      - residue GLU has 9 atoms
        - atom: N x: 22.719999313354492 y:-16.493000030517578 z:26.68899917602539
        - atom: CA x: 23.83099937438965 y:-16.760000228881836 z:27.58300018310547
        - atom: C x: 23.28700065612793 y:-17.075000762939453 z:28.95800018310547
        - atom: O x: 23.738000869750977 y:-18.0049991607666 z:29.625999450683594
        - atom: CB x: 24.726999282836914 y:-15.53600025177002 z:27.64900016784668
        - atom: CG x: 25.850000381469727 y:-15.63599967956543 z:28.64299964904785
        - atom: CD x: 26.965999603271484 y:-14.670000076293945 z:28.30900001525879
        - atom: OE1 x: 27.51799964904785 y:-14.795999526977539 z:27.19700050354004
        - atom: OE2 x: 27.283000946044922 y:-13.788999557495117 z:29.141000747680664
      - residue LYS has 9 atoms
        - atom: N x: 22.308000564575195 y:-16.295000076293945 z:29.381999969482422
        - atom: CA x: 21.725000381469727 y:-16.541000366210938 z:30.672000885009766
        - atom: C x: 20.95199966430664 y:-17.840999603271484 z:30.590999603271484
        - atom: O x: 20.99799919128418 y:-18.648000717163086 z:31.51300048828125
        - atom: CB x: 20.82699966430664 y:-15.378999710083008 z:31.089000701904297
        - atom: CG x: 21.610000610351562 y:-14.130999565124512 z:31.437000274658203
        - atom: CD x: 20.827999114990234 y:-13.210000038146973 z:32.361000061035156
        - atom: CE x: 21.672000885009766 y:-12.029999732971191 z:32.82699966430664
        - atom: NZ x: 22.187999725341797 y:-11.217000007629395 z:31.687999725341797
      - residue ILE has 8 atoms
        - atom: N x: 20.256000518798828 y:-18.055999755859375 z:29.479000091552734
        - atom: CA x: 19.496000289916992 y:-19.285999298095703 z:29.30500030517578
        - atom: C x: 20.44300079345703 y:-20.496999740600586 z:29.367000579833984
        - atom: O x: 20.117000579833984 y:-21.52899932861328 z:29.961999893188477
        - atom: CB x: 18.714000701904297 y:-19.270000457763672 z:27.961999893188477
        - atom: CG1 x: 17.535999298095703 y:-18.297000885009766 z:28.06399917602539
        - atom: CG2 x: 18.194000244140625 y:-20.665000915527344 z:27.6299991607666
        - atom: CD1 x: 16.844999313354492 y:-18.011999130249023 z:26.757999420166016
      - residue ASP has 8 atoms
        - atom: N x: 21.618000030517578 y:-20.37299919128418 z:28.761999130249023
        - atom: CA x: 22.56999969482422 y:-21.466999053955078 z:28.795000076293945
        - atom: C x: 22.993999481201172 y:-21.802000045776367 z:30.23200035095215
        - atom: O x: 23.159000396728516 y:-22.97800064086914 z:30.573999404907227
        - atom: CB x: 23.785999298095703 y:-21.145999908447266 z:27.93199920654297
        - atom: CG x: 23.558000564575195 y:-21.47599983215332 z:26.459999084472656
        - atom: OD1 x: 22.81999969482422 y:-22.45199966430664 z:26.187999725341797
        - atom: OD2 x: 24.12299919128418 y:-20.783000946044922 z:25.57900047302246
      - residue GLU has 9 atoms
        - atom: N x: 23.165000915527344 y:-20.785999298095703 z:31.07900047302246
        - atom: CA x: 23.533000946044922 y:-21.05699920654297 z:32.4640007019043
        - atom: C x: 22.351999282836914 y:-21.722000122070312 z:33.15700149536133
        - atom: O x: 22.476999282836914 y:-22.834999084472656 z:33.65800094604492
        - atom: CB x: 23.89900016784668 y:-19.783000946044922 z:33.233001708984375
        - atom: CG x: 24.15999984741211 y:-20.05900001525879 z:34.72200012207031
        - atom: CD x: 24.485000610351562 y:-18.812999725341797 z:35.542999267578125
        - atom: OE1 x: 25.302000045776367 y:-17.989999771118164 z:35.09000015258789
        - atom: OE2 x: 23.93899917602539 y:-18.665000915527344 z:36.654998779296875
      - residue PHE has 11 atoms
        - atom: N x: 21.201000213623047 y:-21.04800033569336 z:33.17599868774414
        - atom: CA x: 20.01799964904785 y:-21.60300064086914 z:33.83700180053711
        - atom: C x: 19.79599952697754 y:-23.05900001525879 z:33.45500183105469
        - atom: O x: 19.496999740600586 y:-23.89900016784668 z:34.303001403808594
        - atom: CB x: 18.76099967956543 y:-20.81599998474121 z:33.494998931884766
        - atom: CG x: 17.554000854492188 y:-21.259000778198242 z:34.27399826049805
        - atom: CD1 x: 17.402999877929688 y:-20.89900016784668 z:35.61000061035156
        - atom: CD2 x: 16.577999114990234 y:-22.05699920654297 z:33.68299865722656
        - atom: CE1 x: 16.29599952697754 y:-21.326000213623047 z:36.34700012207031
        - atom: CE2 x: 15.472000122070312 y:-22.486000061035156 z:34.4119987487793
        - atom: CZ x: 15.331999778747559 y:-22.1200008392334 z:35.74599838256836
      - residue LEU has 8 atoms
        - atom: N x: 19.929000854492188 y:-23.354999542236328 z:32.16999816894531
        - atom: CA x: 19.76099967956543 y:-24.719999313354492 z:31.724000930786133
        - atom: C x: 20.87299919128418 y:-25.54400062561035 z:32.38100051879883
        - atom: O x: 20.597000122070312 y:-26.49799919128418 z:33.11199951171875
        - atom: CB x: 19.84000015258789 y:-24.78700065612793 z:30.19499969482422
        - atom: CG x: 18.53700065612793 y:-25.14900016784668 z:29.46299934387207
        - atom: CD1 x: 17.368999481201172 y:-24.40399932861328 z:30.06100082397461
        - atom: CD2 x: 18.67099952697754 y:-24.833999633789062 z:27.979999542236328
      - residue ALA has 5 atoms
        - atom: N x: 22.125 y:-25.1560001373291 z:32.15299987792969
        - atom: CA x: 23.2549991607666 y:-25.881000518798828 z:32.73099899291992
        - atom: C x: 23.19700050354004 y:-25.913000106811523 z:34.263999938964844
        - atom: O x: 22.674999237060547 y:-26.856000900268555 z:34.8650016784668
        - atom: CB x: 24.572999954223633 y:-25.256999969482422 z:32.26499938964844
      - residue THR has 7 atoms
        - atom: N x: 23.732999801635742 y:-24.874000549316406 z:34.891998291015625
        - atom: CA x: 23.746999740600586 y:-24.791000366210938 z:36.345001220703125
        - atom: C x: 22.393999099731445 y:-25.16200065612793 z:36.95800018310547
        - atom: O x: 22.26799964904785 y:-26.194000244140625 z:37.60900115966797
        - atom: CB x: 24.17799949645996 y:-23.371000289916992 z:36.810001373291016
        - atom: OG1 x: 23.086000442504883 y:-22.448999404907227 z:36.68899917602539
        - atom: CG2 x: 25.349000930786133 y:-22.87700080871582 z:35.946998596191406
      - residue GLY has 4 atoms
        - atom: N x: 21.3799991607666 y:-24.339000701904297 z:36.72800064086914
        - atom: CA x: 20.069000244140625 y:-24.611000061035156 z:37.29199981689453
        - atom: C x: 19.61400032043457 y:-23.41699981689453 z:38.10900115966797
        - atom: O x: 18.61400032043457 y:-23.454999923706055 z:38.83599853515625
      - residue LYS has 9 atoms
        - atom: N x: 20.375999450683594 y:-22.34000015258789 z:37.97700119018555
        - atom: CA x: 20.104999542236328 y:-21.104000091552734 z:38.680999755859375
        - atom: C x: 20.933000564575195 y:-20.047000885009766 z:37.987998962402344
        - atom: O x: 21.757999420166016 y:-20.365999221801758 z:37.137001037597656
        - atom: CB x: 20.530000686645508 y:-21.229999542236328 z:40.150001525878906
        - atom: CG x: 22.016000747680664 y:-21.55299949645996 z:40.37799835205078
        - atom: CD x: 22.30500030517578 y:-21.792999267578125 z:41.87099838256836
        - atom: CE x: 23.71500015258789 y:-22.350000381469727 z:42.15399932861328
        - atom: NZ x: 24.823999404907227 y:-21.365999221801758 z:41.97200012207031
      - residue LEU has 8 atoms
        - atom: N x: 20.711000442504883 y:-18.78700065612793 z:38.33000183105469
        - atom: CA x: 21.5 y:-17.73200035095215 z:37.724998474121094
        - atom: C x: 22.31999969482422 y:-17.052000045776367 z:38.80699920654297
        - atom: O x: 21.7810001373291 y:-16.632999420166016 z:39.83000183105469
        - atom: CB x: 20.608999252319336 y:-16.709999084472656 z:37.027000427246094
        - atom: CG x: 21.32699966430664 y:-15.911999702453613 z:35.935001373291016
        - atom: CD1 x: 21.85099983215332 y:-16.854000091552734 z:34.85599899291992
        - atom: CD2 x: 20.36400032043457 y:-14.904999732971191 z:35.32699966430664
      - residue ARG has 11 atoms
        - atom: N x: 23.6299991607666 y:-16.968000411987305 z:38.57899856567383
        - atom: CA x: 24.55500030517578 y:-16.33300018310547 z:39.516998291015625
        - atom: C x: 24.148000717163086 y:-14.880000114440918 z:39.749000549316406
        - atom: O x: 24.016000747680664 y:-14.442000389099121 z:40.891998291015625
        - atom: CB x: 25.979000091552734 y:-16.405000686645508 z:38.9640007019043
        - atom: CG x: 26.475000381469727 y:-17.833999633789062 z:38.73099899291992
        - atom: CD x: 27.805999755859375 y:-17.840999603271484 z:37.98899841308594
        - atom: NE x: 27.750999450683594 y:-16.979000091552734 z:36.808998107910156
        - atom: CZ x: 28.722999572753906 y:-16.86400032043457 z:35.904998779296875
        - atom: NH1 x: 29.840999603271484 y:-17.56399917602539 z:36.03200149536133
        - atom: NH2 x: 28.58300018310547 y:-16.033000946044922 z:34.875999450683594
      - residue LYS has 9 atoms
        - atom: N x: 23.94099998474121 y:-14.14799976348877 z:38.65700149536133
        - atom: CA x: 23.523000717163086 y:-12.746999740600586 z:38.71799850463867
        - atom: C x: 22.263999938964844 y:-12.520000457763672 z:39.571998596191406
        - atom: O x: 22.094999313354492 y:-11.446999549865723 z:40.1609992980957
        - atom: CB x: 23.275999069213867 y:-12.211000442504883 z:37.30699920654297
        - atom: CG x: 22.777999877929688 y:-10.774999618530273 z:37.26499938964844
        - atom: CD x: 22.426000595092773 y:-10.364999771118164 z:35.8489990234375
        - atom: CE x: 21.812000274658203 y:-8.97700023651123 z:35.79999923706055
        - atom: NZ x: 22.783000946044922 y:-7.9079999923706055 z:36.16999816894531
      - residue LEU has 8 atoms
        - atom: N x: 21.37700080871582 y:-13.51099967956543 z:39.630001068115234
        - atom: CA x: 20.15399932861328 y:-13.38599967956543 z:40.43600082397461
        - atom: C x: 20.409000396728516 y:-13.715999603271484 z:41.909000396728516
        - atom: O x: 19.76099967956543 y:-13.151000022888184 z:42.79199981689453
        - atom: CB x: 19.0310001373291 y:-14.29800033569336 z:39.91299819946289
        - atom: CG x: 18.204999923706055 y:-13.871000289916992 z:38.69599914550781
        - atom: CD1 x: 17.20599937438965 y:-14.956000328063965 z:38.374000549316406
        - atom: CD2 x: 17.489999771118164 y:-12.565999984741211 z:38.97100067138672
      - residue GLU has 9 atoms
        - atom: N x: 21.33099937438965 y:-14.642000198364258 z:42.17399978637695
        - atom: CA x: 21.6560001373291 y:-14.987000465393066 z:43.553001403808594
        - atom: C x: 22.179000854492188 y:-13.70199966430664 z:44.17900085449219
        - atom: O x: 21.764999389648438 y:-13.3149995803833 z:45.27199935913086
        - atom: CB x: 22.73900032043457 y:-16.07699966430664 z:43.624000549316406
        - atom: CG x: 22.267000198364258 y:-17.479999542236328 z:43.24599838256836
        - atom: CD x: 21.235000610351562 y:-18.04599952697754 z:44.209999084472656
        - atom: OE1 x: 20.523000717163086 y:-18.98900032043457 z:43.81399917602539
        - atom: OE2 x: 21.13599967956543 y:-17.562999725341797 z:45.36000061035156
      - residue LYS has 9 atoms
        - atom: N x: 23.073999404907227 y:-13.038000106811523 z:43.45399856567383
        - atom: CA x: 23.663999557495117 y:-11.78600025177002 z:43.90700149536133
        - atom: C x: 22.57200050354004 y:-10.781999588012695 z:44.24700164794922
        - atom: O x: 22.555999755859375 y:-10.211999893188477 z:45.334999084472656
        - atom: CB x: 24.594999313354492 y:-11.241999626159668 z:42.821998596191406
        - atom: CG x: 25.749000549316406 y:-12.201000213623047 z:42.54100036621094
        - atom: CD x: 26.69700050354004 y:-11.706000328063965 z:41.46500015258789
        - atom: CE x: 27.738000869750977 y:-12.774999618530273 z:41.16299819946289
        - atom: NZ x: 28.597999572753906 y:-12.456000328063965 z:39.9900016784668
      - residue ILE has 8 atoms
        - atom: N x: 21.650999069213867 y:-10.579999923706055 z:43.3129997253418
        - atom: CA x: 20.538999557495117 y:-9.666999816894531 z:43.53300094604492
        - atom: C x: 19.79400062561035 y:-10.114999771118164 z:44.78499984741211
        - atom: O x: 19.698999404907227 y:-9.368000030517578 z:45.75299835205078
        - atom: CB x: 19.576000213623047 y:-9.663000106811523 z:42.31800079345703
        - atom: CG1 x: 20.308000564575195 y:-9.105999946594238 z:41.09299850463867
        - atom: CG2 x: 18.336999893188477 y:-8.845999717712402 z:42.625
        - atom: CD1 x: 19.481000900268555 y:-9.064000129699707 z:39.84400177001953
      - residue ARG has 11 atoms
        - atom: N x: 19.283000946044922 y:-11.342000007629395 z:44.7599983215332
        - atom: CA x: 18.551000595092773 y:-11.920999526977539 z:45.88999938964844
        - atom: C x: 19.215999603271484 y:-11.687000274658203 z:47.249000549316406
        - atom: O x: 18.5310001373291 y:-11.527000427246094 z:48.262001037597656
        - atom: CB x: 18.378999710083008 y:-13.430000305175781 z:45.68199920654297
        - atom: CG x: 17.430999755859375 y:-13.803000450134277 z:44.56800079345703
        - atom: CD x: 17.413000106811523 y:-15.305000305175781 z:44.323001861572266
        - atom: NE x: 16.273000717163086 y:-15.689000129699707 z:43.492000579833984
        - atom: CZ x: 15.977999687194824 y:-16.937000274658203 z:43.132999420166016
        - atom: NH1 x: 16.740999221801758 y:-17.950000762939453 z:43.525001525878906
        - atom: NH2 x: 14.906000137329102 y:-17.176000595092773 z:42.38800048828125
      - residue GLN has 9 atoms
        - atom: N x: 20.548999786376953 y:-11.678999900817871 z:47.263999938964844
        - atom: CA x: 21.320999145507812 y:-11.486000061035156 z:48.492000579833984
        - atom: C x: 21.540000915527344 y:-10.038999557495117 z:48.88999938964844
        - atom: O x: 21.20199966430664 y:-9.645999908447266 z:50.005001068115234
        - atom: CB x: 22.667999267578125 y:-12.187999725341797 z:48.374000549316406
        - atom: CG x: 22.65399932861328 y:-13.574000358581543 z:48.97700119018555
        - atom: CD x: 23.506999969482422 y:-14.543000221252441 z:48.20399856567383
        - atom: OE1 x: 24.591999053955078 y:-14.189000129699707 z:47.731998443603516
        - atom: NE2 x: 23.027000427246094 y:-15.782999992370605 z:48.07099914550781
      - residue ASP has 8 atoms
        - atom: N x: 22.11400032043457 y:-9.253000259399414 z:47.983001708984375
        - atom: CA x: 22.3700008392334 y:-7.834000110626221 z:48.22999954223633
        - atom: C x: 21.216999053955078 y:-7.169000148773193 z:48.99300003051758
        - atom: O x: 20.115999221801758 y:-7.050000190734863 z:48.47700119018555
        - atom: CB x: 22.594999313354492 y:-7.125999927520752 z:46.89099884033203
        - atom: CG x: 22.950000762939453 y:-5.663000106811523 z:47.05400085449219
        - atom: OD1 x: 23.440000534057617 y:-5.063000202178955 z:46.07400131225586
        - atom: OD2 x: 22.735000610351562 y:-5.116000175476074 z:48.15800094604492
      - residue ASP has 8 atoms
        - atom: N x: 21.47599983215332 y:-6.7230000495910645 z:50.21699905395508
        - atom: CA x: 20.43600082397461 y:-6.09499979019165 z:51.03499984741211
        - atom: C x: 19.680999755859375 y:-4.929999828338623 z:50.38100051879883
        - atom: O x: 18.44499969482422 y:-4.921999931335449 z:50.34199905395508
        - atom: CB x: 21.023000717163086 y:-5.610000133514404 z:52.36600112915039
        - atom: CG x: 20.0 y:-4.864999771118164 z:53.21699905395508
        - atom: OD1 x: 19.062999725341797 y:-5.508999824523926 z:53.75
        - atom: OD2 x: 20.125 y:-3.630000114440918 z:53.34400177001953
      - residue THR has 7 atoms
        - atom: N x: 20.41900062561035 y:-3.941999912261963 z:49.88199996948242
        - atom: CA x: 19.788000106811523 y:-2.7799999713897705 z:49.266998291015625
        - atom: C x: 18.878999710083008 y:-3.131999969482422 z:48.10300064086914
        - atom: O x: 17.701000213623047 y:-2.7730000019073486 z:48.104000091552734
        - atom: CB x: 20.826000213623047 y:-1.7740000486373901 z:48.766998291015625
        - atom: OG1 x: 21.684999465942383 y:-1.3969999551773071 z:49.84700012207031
        - atom: CG2 x: 20.131000518798828 y:-0.531000018119812 z:48.229000091552734
      - residue SER has 6 atoms
        - atom: N x: 19.43400001525879 y:-3.8239998817443848 z:47.11199951171875
        - atom: CA x: 18.676000595092773 y:-4.2210001945495605 z:45.930999755859375
        - atom: C x: 17.445999145507812 y:-4.991000175476074 z:46.375999450683594
        - atom: O x: 16.354000091552734 y:-4.8429999351501465 z:45.827999114990234
        - atom: CB x: 19.527999877929688 y:-5.125999927520752 z:45.04399871826172
        - atom: OG x: 20.857999801635742 y:-4.6479997634887695 z:44.95500183105469
      - residue SER has 6 atoms
        - atom: N x: 17.650999069213867 y:-5.809000015258789 z:47.39699935913086
        - atom: CA x: 16.614999771118164 y:-6.6579999923706055 z:47.946998596191406
        - atom: C x: 15.543000221252441 y:-5.864999771118164 z:48.672000885009766
        - atom: O x: 14.366999626159668 y:-6.239999771118164 z:48.676998138427734
        - atom: CB x: 17.256999969482422 y:-7.659999847412109 z:48.895999908447266
        - atom: OG x: 16.29199981689453 y:-8.527000427246094 z:49.439998626708984
      - residue SER has 6 atoms
        - atom: N x: 15.956999778747559 y:-4.765999794006348 z:49.28799819946289
        - atom: CA x: 15.032999992370605 y:-3.927000045776367 z:50.02299880981445
        - atom: C x: 14.21399974822998 y:-3.0350000858306885 z:49.106998443603516
        - atom: O x: 13.001999855041504 y:-2.947000026702881 z:49.257999420166016
        - atom: CB x: 15.791999816894531 y:-3.0929999351501465 z:51.06100082397461
        - atom: OG x: 16.2549991607666 y:-3.9210000038146973 z:52.12300109863281
      - residue ILE has 8 atoms
        - atom: N x: 14.859999656677246 y:-2.371999979019165 z:48.159000396728516
        - atom: CA x: 14.121000289916992 y:-1.5190000534057617 z:47.24399948120117
        - atom: C x: 13.07699966430664 y:-2.390000104904175 z:46.57600021362305
        - atom: O x: 11.907999992370605 y:-2.01200008392334 z:46.41999816894531
        - atom: CB x: 15.031999588012695 y:-0.9359999895095825 z:46.16899871826172
        - atom: CG1 x: 16.11400032043457 y:-0.07800000160932541 z:46.83300018310547
        - atom: CG2 x: 14.199000358581543 y:-0.11400000005960464 z:45.18199920654297
        - atom: CD1 x: 17.23699951171875 y:0.3479999899864197 z:45.91999816894531
      - residue ASN has 8 atoms
        - atom: N x: 13.520000457763672 y:-3.5810000896453857 z:46.20199966430664
        - atom: CA x: 12.65999984741211 y:-4.548999786376953 z:45.5620002746582
        - atom: C x: 11.432000160217285 y:-4.789000034332275 z:46.38999938964844
        - atom: O x: 10.333999633789062 y:-4.831999778747559 z:45.874000549316406
        - atom: CB x: 13.383999824523926 y:-5.864999771118164 z:45.374000549316406
        - atom: CG x: 13.378999710083008 y:-6.310999870300293 z:43.948001861572266
        - atom: OD1 x: 12.390000343322754 y:-6.114999771118164 z:43.23500061035156
        - atom: ND2 x: 14.47599983215332 y:-6.923999786376953 z:43.51100158691406
      - residue PHE has 11 atoms
        - atom: N x: 11.60099983215332 y:-4.936999797821045 z:47.6879997253418
        - atom: CA x: 10.439000129699707 y:-5.195000171661377 z:48.50699996948242
        - atom: C x: 9.46399974822998 y:-4.026000022888184 z:48.55799865722656
        - atom: O x: 8.288000106811523 y:-4.184000015258789 z:48.26900100708008
        - atom: CB x: 10.843999862670898 y:-5.577000141143799 z:49.92599868774414
        - atom: CG x: 9.680000305175781 y:-5.688000202178955 z:50.8489990234375
        - atom: CD1 x: 8.789999961853027 y:-6.736999988555908 z:50.729000091552734
        - atom: CD2 x: 9.430999755859375 y:-4.703000068664551 z:51.792999267578125
        - atom: CE1 x: 7.666999816894531 y:-6.803999900817871 z:51.534000396728516
        - atom: CE2 x: 8.303000450134277 y:-4.763999938964844 z:52.60100173950195
        - atom: CZ x: 7.425000190734863 y:-5.815000057220459 z:52.47100067138672
      - residue LEU has 8 atoms
        - atom: N x: 9.954999923706055 y:-2.8559999465942383 z:48.935001373291016
        - atom: CA x: 9.11299991607666 y:-1.6629999876022339 z:49.029998779296875
        - atom: C x: 8.187000274658203 y:-1.444000005722046 z:47.8489990234375
        - atom: O x: 6.998000144958496 y:-1.2089999914169312 z:48.0359992980957
        - atom: CB x: 9.97599983215332 y:-0.42399999499320984 z:49.19599914550781
        - atom: CG x: 10.741999626159668 y:-0.367000013589859 z:50.50699996948242
        - atom: CD1 x: 11.949000358581543 y:0.5139999985694885 z:50.32600021362305
        - atom: CD2 x: 9.82699966430664 y:0.1289999932050705 z:51.612998962402344
      - residue THR has 7 atoms
        - atom: N x: 8.727999687194824 y:-1.5180000066757202 z:46.63600158691406
        - atom: CA x: 7.913000106811523 y:-1.3020000457763672 z:45.45000076293945
        - atom: C x: 6.660999774932861 y:-2.1670000553131104 z:45.41999816894531
        - atom: O x: 5.74399995803833 y:-1.86899995803833 z:44.67499923706055
        - atom: CB x: 8.699999809265137 y:-1.5509999990463257 z:44.16999816894531
        - atom: OG1 x: 8.991000175476074 y:-2.943000078201294 z:44.060001373291016
        - atom: CG2 x: 9.998000144958496 y:-0.7699999809265137 z:44.17599868774414
      - residue ARG has 11 atoms
        - atom: N x: 6.604000091552734 y:-3.2290000915527344 z:46.2239990234375
        - atom: CA x: 5.4070000648498535 y:-4.083000183105469 z:46.25
        - atom: C x: 4.270999908447266 y:-3.384000062942505 z:46.97600173950195
        - atom: O x: 3.1610000133514404 y:-3.9130001068115234 z:47.06999969482422
        - atom: CB x: 5.684999942779541 y:-5.426000118255615 z:46.926998138427734
        - atom: CG x: 6.485000133514404 y:-6.410999774932861 z:46.06700134277344
        - atom: CD x: 7.070000171661377 y:-7.552000045776367 z:46.89799880981445
        - atom: NE x: 6.085000038146973 y:-8.112000465393066 z:47.81800079345703
        - atom: CZ x: 6.336999893188477 y:-9.085000038146973 z:48.68600082397461
        - atom: NH1 x: 7.546000003814697 y:-9.621999740600586 z:48.762001037597656
        - atom: NH2 x: 5.382999897003174 y:-9.510000228881836 z:49.492000579833984
      - residue VAL has 7 atoms
        - atom: N x: 4.554999828338623 y:-2.2019999027252197 z:47.51300048828125
        - atom: CA x: 3.5380001068115234 y:-1.4140000343322754 z:48.19200134277344
        - atom: C x: 3.002000093460083 y:-0.4729999899864197 z:47.124000549316406
        - atom: O x: 3.7679998874664307 y:0.1459999978542328 z:46.38100051879883
        - atom: CB x: 4.129000186920166 y:-0.6010000109672546 z:49.367000579833984
        - atom: CG1 x: 3.115000009536743 y:0.40299999713897705 z:49.87699890136719
        - atom: CG2 x: 4.514999866485596 y:-1.5449999570846558 z:50.49800109863281
      - residue SER has 6 atoms
        - atom: N x: 1.6820000410079956 y:-0.3880000114440918 z:47.029998779296875
        - atom: CA x: 1.0529999732971191 y:0.453000009059906 z:46.0260009765625
        - atom: C x: 1.2309999465942383 y:1.902999997138977 z:46.388999938964844
        - atom: O x: 0.7540000081062317 y:2.3459999561309814 z:47.4370002746582
        - atom: CB x: -0.4350000023841858 y:0.12800000607967377 z:45.922000885009766
        - atom: OG x: -0.9639999866485596 y:0.6510000228881836 z:44.733001708984375
      - residue GLY has 4 atoms
        - atom: N x: 1.9040000438690186 y:2.6449999809265137 z:45.51599884033203
        - atom: CA x: 2.1429998874664307 y:4.053999900817871 z:45.7760009765625
        - atom: C x: 3.634999990463257 y:4.316999912261963 z:45.90299987792969
        - atom: O x: 4.10099983215332 y:5.461999893188477 z:45.915000915527344
      - residue ILE has 8 atoms
        - atom: N x: 4.392000198364258 y:3.2300000190734863 z:45.9900016784668
        - atom: CA x: 5.824999809265137 y:3.325000047683716 z:46.11600112915039
        - atom: C x: 6.491000175476074 y:2.7769999504089355 z:44.880001068115234
        - atom: O x: 6.464000225067139 y:1.5800000429153442 z:44.64099884033203
        - atom: CB x: 6.308000087738037 y:2.569000005722046 z:47.356998443603516
        - atom: CG1 x: 5.689000129699707 y:3.2200000286102295 z:48.59600067138672
        - atom: CG2 x: 7.823999881744385 y:2.5880000591278076 z:47.42300033569336
        - atom: CD1 x: 5.960000038146973 y:2.489000082015991 z:49.89400100708008
      - residue GLY has 4 atoms
        - atom: N x: 7.071000099182129 y:3.6670000553131104 z:44.08700180053711
        - atom: CA x: 7.74399995803833 y:3.2360000610351562 z:42.8849983215332
        - atom: C x: 9.239999771118164 y:3.2160000801086426 z:43.108001708984375
        - atom: O x: 9.706999778747559 y:3.369999885559082 z:44.23500061035156
      - residue PRO has 7 atoms
        - atom: N x: 10.027999877929688 y:3.0280001163482666 z:42.04600143432617
        - atom: CA x: 11.480999946594238 y:3.003999948501587 z:42.20600128173828
        - atom: C x: 11.973999977111816 y:4.1529998779296875 z:43.07600021362305
        - atom: O x: 12.366000175476074 y:3.944999933242798 z:44.2140007019043
        - atom: CB x: 11.97599983215332 y:3.0999999046325684 z:40.766998291015625
        - atom: CG x: 10.942999839782715 y:2.306999921798706 z:40.03300094604492
        - atom: CD x: 9.645000457763672 y:2.819000005722046 z:40.638999938964844
      - residue SER has 6 atoms
        - atom: N x: 11.925999641418457 y:5.367000102996826 z:42.54199981689453
        - atom: CA x: 12.390000343322754 y:6.557000160217285 z:43.24700164794922
        - atom: C x: 12.029000282287598 y:6.611000061035156 z:44.720001220703125
        - atom: O x: 12.913999557495117 y:6.75 z:45.55099868774414
        - atom: CB x: 11.88700008392334 y:7.824999809265137 z:42.54899978637695
        - atom: OG x: 12.267000198364258 y:9.003000259399414 z:43.255001068115234
      - residue ALA has 5 atoms
        - atom: N x: 10.75 y:6.5229997634887695 z:45.060001373291016
        - atom: CA x: 10.368000030517578 y:6.559999942779541 z:46.47700119018555
        - atom: C x: 11.04699993133545 y:5.427999973297119 z:47.2599983215332
        - atom: O x: 11.673999786376953 y:5.670000076293945 z:48.2869987487793
        - atom: CB x: 8.85200023651123 y:6.466000080108643 z:46.63600158691406
      - residue ALA has 5 atoms
        - atom: N x: 10.935999870300293 y:4.192999839782715 z:46.78499984741211
        - atom: CA x: 11.574999809265137 y:3.0989999771118164 z:47.499000549316406
        - atom: C x: 13.069999694824219 y:3.3540000915527344 z:47.66600036621094
        - atom: O x: 13.619000434875488 y:3.138000011444092 z:48.733001708984375
        - atom: CB x: 11.357000350952148 y:1.7940000295639038 z:46.77399826049805
      - residue ARG has 11 atoms
        - atom: N x: 13.737000465393066 y:3.808000087738037 z:46.617000579833984
        - atom: CA x: 15.163999557495117 y:4.068999767303467 z:46.73899841308594
        - atom: C x: 15.439000129699707 y:5.125999927520752 z:47.801998138427734
        - atom: O x: 16.441999435424805 y:5.046999931335449 z:48.50899887084961
        - atom: CB x: 15.765000343322754 y:4.5269999504089355 z:45.41400146484375
        - atom: CG x: 17.187000274658203 y:5.013999938964844 z:45.55500030517578
        - atom: CD x: 17.774999618530273 y:5.38100004196167 z:44.2130012512207
        - atom: NE x: 17.91900062561035 y:4.206999778747559 z:43.36199951171875
        - atom: CZ x: 18.624000549316406 y:3.128000020980835 z:43.6879997253418
        - atom: NH1 x: 19.253999710083008 y:3.075000047683716 z:44.85200119018555
        - atom: NH2 x: 18.694000244140625 y:2.1010000705718994 z:42.85100173950195
      - residue LYS has 9 atoms
        - atom: N x: 14.557000160217285 y:6.117000102996826 z:47.91299819946289
        - atom: CA x: 14.75 y:7.156000137329102 z:48.909000396728516
        - atom: C x: 14.637999534606934 y:6.564000129699707 z:50.31399917602539
        - atom: O x: 15.583000183105469 y:6.656000137329102 z:51.0880012512207
        - atom: CB x: 13.739999771118164 y:8.288999557495117 z:48.73099899291992
        - atom: CG x: 13.96399974822998 y:9.401000022888184 z:49.72600173950195
        - atom: CD x: 13.178999900817871 y:10.670000076293945 z:49.441001892089844
        - atom: CE x: 13.61400032043457 y:11.75100040435791 z:50.43299865722656
        - atom: NZ x: 12.967000007629395 y:13.07800006866455 z:50.22100067138672
      - residue PHE has 11 atoms
        - atom: N x: 13.501999855041504 y:5.952000141143799 z:50.64099884033203
        - atom: CA x: 13.32699966430664 y:5.343999862670898 z:51.95600128173828
        - atom: C x: 14.543999671936035 y:4.506999969482422 z:52.38100051879883
        - atom: O x: 15.128999710083008 y:4.742000102996826 z:53.430999755859375
        - atom: CB x: 12.090999603271484 y:4.448999881744385 z:51.974998474121094
        - atom: CG x: 10.807000160217285 y:5.189000129699707 z:51.819000244140625
        - atom: CD1 x: 10.470999717712402 y:6.210000038146973 z:52.6879997253418
        - atom: CD2 x: 9.913000106811523 y:4.8480000495910645 z:50.8129997253418
        - atom: CE1 x: 9.260000228881836 y:6.885000228881836 z:52.5629997253418
        - atom: CE2 x: 8.70199966430664 y:5.513000011444092 z:50.67900085449219
        - atom: CZ x: 8.378000259399414 y:6.534999847412109 z:51.560001373291016
      - residue VAL has 7 atoms
        - atom: N x: 14.911999702453613 y:3.5230000019073486 z:51.564998626708984
        - atom: CA x: 16.048999786376953 y:2.6570000648498535 z:51.86399841308594
        - atom: C x: 17.27199935913086 y:3.493000030517578 z:52.22100067138672
        - atom: O x: 17.93000030517578 y:3.2239999771118164 z:53.21799850463867
        - atom: CB x: 16.365999221801758 y:1.7050000429153442 z:50.66899871826172
        - atom: CG1 x: 17.589000701904297 y:0.8560000061988831 z:50.96099853515625
        - atom: CG2 x: 15.1850004196167 y:0.796999990940094 z:50.41600036621094
      - residue ASP has 8 atoms
        - atom: N x: 17.565000534057617 y:4.51800012588501 z:51.428001403808594
        - atom: CA x: 18.70800018310547 y:5.386000156402588 z:51.70800018310547
        - atom: C x: 18.582000732421875 y:6.093999862670898 z:53.05699920654297
        - atom: O x: 19.562000274658203 y:6.625999927520752 z:53.564998626708984
        - atom: CB x: 18.885000228881836 y:6.446000099182129 z:50.612998962402344
        - atom: CG x: 19.240999221801758 y:5.841000080108643 z:49.27000045776367
        - atom: OD1 x: 19.964000701904297 y:4.815999984741211 z:49.257999420166016
        - atom: OD2 x: 18.80900001525879 y:6.396999835968018 z:48.229000091552734
      - residue GLU has 9 atoms
        - atom: N x: 17.381000518798828 y:6.117000102996826 z:53.62699890136719
        - atom: CA x: 17.163999557495117 y:6.752999782562256 z:54.92300033569336
        - atom: C x: 16.847999572753906 y:5.6570000648498535 z:55.96799850463867
        - atom: O x: 16.23900032043457 y:5.9070000648498535 z:57.007999420166016
        - atom: CB x: 16.024999618530273 y:7.790999889373779 z:54.821998596191406
        - atom: CG x: 16.170000076293945 y:8.746000289916992 z:53.61800003051758
        - atom: CD x: 15.095000267028809 y:9.843000411987305 z:53.54600143432617
        - atom: OE1 x: 13.904000282287598 y:9.550999641418457 z:53.82699966430664
        - atom: OE2 x: 15.446000099182129 y:10.996000289916992 z:53.183998107910156
      - residue GLY has 4 atoms
        - atom: N x: 17.257999420166016 y:4.429999828338623 z:55.65800094604492
        - atom: CA x: 17.05900001525879 y:3.325000047683716 z:56.571998596191406
        - atom: C x: 15.710000038146973 y:2.6449999809265137 z:56.645999908447266
        - atom: O x: 15.593000411987305 y:1.6239999532699585 z:57.33100128173828
      - residue ILE has 8 atoms
        - atom: N x: 14.696999549865723 y:3.197999954223633 z:55.98099899291992
        - atom: CA x: 13.359000205993652 y:2.5959999561309814 z:55.972999572753906
        - atom: C x: 13.357000350952148 y:1.5210000276565552 z:54.89799880981445
        - atom: O x: 13.423999786376953 y:1.8480000495910645 z:53.7130012512207
        - atom: CB x: 12.27299976348877 y:3.614000082015991 z:55.59700012207031
        - atom: CG1 x: 12.300999641418457 y:4.796999931335449 z:56.5620002746582
        - atom: CG2 x: 10.91100025177002 y:2.947999954223633 z:55.63399887084961
        - atom: CD1 x: 11.234000205993652 y:5.835999965667725 z:56.28099822998047
      - residue LYS has 9 atoms
        - atom: N x: 13.265000343322754 y:0.25099998712539673 z:55.29199981689453
        - atom: CA x: 13.29800033569336 y:-0.828000009059906 z:54.305999755859375
        - atom: C x: 12.36299991607666 y:-2.01200008392334 z:54.54800033569336
        - atom: O x: 12.54699993133545 y:-3.068000078201294 z:53.96500015258789
        - atom: CB x: 14.72599983215332 y:-1.3580000400543213 z:54.194000244140625
        - atom: CG x: 15.210000038146973 y:-2.0199999809265137 z:55.479000091552734
        - atom: CD x: 16.617000579833984 y:-2.6059999465942383 z:55.35300064086914
        - atom: CE x: 17.683000564575195 y:-1.5269999504089355 z:55.19200134277344
        - atom: NZ x: 19.045000076293945 y:-2.1089999675750732 z:55.125999450683594
      - residue THR has 7 atoms
        - atom: N x: 11.362000465393066 y:-1.8580000400543213 z:55.39500045776367
        - atom: CA x: 10.472999572753906 y:-2.9719998836517334 z:55.65399932861328
        - atom: C x: 9.10200023651123 y:-2.507999897003174 z:56.108001708984375
        - atom: O x: 8.946999549865723 y:-1.378999948501587 z:56.555999755859375
        - atom: CB x: 11.092000007629395 y:-3.8940000534057617 z:56.70600128173828
        - atom: OG1 x: 11.718000411987305 y:-3.0959999561309814 z:57.71200180053711
        - atom: CG2 x: 12.14799976348877 y:-4.789000034332275 z:56.07899856567383
      - residue LEU has 8 atoms
        - atom: N x: 8.11299991607666 y:-3.38700008392334 z:55.98899841308594
        - atom: CA x: 6.741000175476074 y:-3.065000057220459 z:56.361000061035156
        - atom: C x: 6.663000106811523 y:-2.3540000915527344 z:57.698001861572266
        - atom: O x: 5.9079999923706055 y:-1.3930000066757202 z:57.867000579833984
        - atom: CB x: 5.900000095367432 y:-4.335999965667725 z:56.41899871826172
        - atom: CG x: 4.75600004196167 y:-4.4770002365112305 z:55.40999984741211
        - atom: CD1 x: 5.265999794006348 y:-4.355999946594238 z:53.98500061035156
        - atom: CD2 x: 4.0980000495910645 y:-5.828000068664551 z:55.604000091552734
      - residue GLU has 9 atoms
        - atom: N x: 7.443999767303467 y:-2.8399999141693115 z:58.652000427246094
        - atom: CA x: 7.4720001220703125 y:-2.259000062942505 z:59.97999954223633
        - atom: C x: 7.995999813079834 y:-0.824999988079071 z:59.93000030517578
        - atom: O x: 7.494999885559082 y:0.04899999871850014 z:60.625
        - atom: CB x: 8.338000297546387 y:-3.124000072479248 z:60.90299987792969
        - atom: CG x: 7.71999979019165 y:-4.488999843597412 z:61.23899841308594
        - atom: CD x: 7.673999786376953 y:-5.454999923706055 z:60.05400085449219
        - atom: OE1 x: 8.753000259399414 y:-5.8520002365112305 z:59.5629997253418
        - atom: OE2 x: 6.560999870300293 y:-5.826000213623047 z:59.61600112915039
      - residue ASP has 8 atoms
        - atom: N x: 9.005000114440918 y:-0.5849999785423279 z:59.104000091552734
        - atom: CA x: 9.571999549865723 y:0.7480000257492065 z:58.9739990234375
        - atom: C x: 8.531999588012695 y:1.718000054359436 z:58.41600036621094
        - atom: O x: 8.362000465393066 y:2.8380000591278076 z:58.92399978637695
        - atom: CB x: 10.795999526977539 y:0.6819999814033508 z:58.07600021362305
        - atom: CG x: 11.92300033569336 y:-0.08399999886751175 z:58.7140007019043
        - atom: OD1 x: 11.635000228881836 y:-1.0809999704360962 z:59.4010009765625
        - atom: OD2 x: 13.090999603271484 y:0.3059999942779541 z:58.529998779296875
      - residue LEU has 8 atoms
        - atom: N x: 7.834000110626221 y:1.2890000343322754 z:57.37099838256836
        - atom: CA x: 6.793000221252441 y:2.117000102996826 z:56.79399871826172
        - atom: C x: 5.763000011444092 y:2.321000099182129 z:57.895999908447266
        - atom: O x: 5.111000061035156 y:3.3589999675750732 z:57.95600128173828
        - atom: CB x: 6.164000034332275 y:1.4190000295639038 z:55.58599853515625
        - atom: CG x: 7.113999843597412 y:1.1069999933242798 z:54.428001403808594
        - atom: CD1 x: 6.370999813079834 y:0.3479999899864197 z:53.361000061035156
        - atom: CD2 x: 7.696000099182129 y:2.390000104904175 z:53.86399841308594
      - residue ARG has 11 atoms
        - atom: N x: 5.632999897003174 y:1.3179999589920044 z:58.76499938964844
        - atom: CA x: 4.715000152587891 y:1.3680000305175781 z:59.90700149536133
        - atom: C x: 5.168000221252441 y:2.438999891281128 z:60.90299987792969
        - atom: O x: 4.3460001945495605 y:3.1530001163482666 z:61.48099899291992
        - atom: CB x: 4.678999900817871 y:0.017999999225139618 z:60.619998931884766
        - atom: CG x: 3.812999963760376 y:-1.0190000534057617 z:59.95800018310547
        - atom: CD x: 2.361999988555908 y:-0.7979999780654907 z:60.33000183105469
        - atom: NE x: 1.4429999589920044 y:-1.5540000200271606 z:59.483001708984375
        - atom: CZ x: 1.4910000562667847 y:-2.869999885559082 z:59.29999923706055
        - atom: NH1 x: 2.4179999828338623 y:-3.5999999046325684 z:59.909000396728516
        - atom: NH2 x: 0.6159999966621399 y:-3.4560000896453857 z:58.4900016784668
      - residue LYS has 9 atoms
        - atom: N x: 6.4770002365112305 y:2.5450000762939453 z:61.104000091552734
        - atom: CA x: 7.011000156402588 y:3.5309998989105225 z:62.02199935913086
        - atom: C x: 6.9720001220703125 y:4.920000076293945 z:61.40399932861328
        - atom: O x: 6.544000148773193 y:5.894000053405762 z:62.04800033569336
        - atom: CB x: 8.460000038146973 y:3.2070000171661377 z:62.402000427246094
        - atom: CG x: 9.081999778747559 y:4.255000114440918 z:63.327999114990234
        - atom: CD x: 10.49899959564209 y:3.9030001163482666 z:63.790000915527344
        - atom: CE x: 11.552000045776367 y:4.183000087738037 z:62.72600173950195
        - atom: NZ x: 12.932000160217285 y:4.047999858856201 z:63.28200149536133
      - residue ASN has 8 atoms
        - atom: N x: 7.419000148773193 y:5.011000156402588 z:60.154998779296875
        - atom: CA x: 7.459000110626221 y:6.291999816894531 z:59.483001708984375
        - atom: C x: 6.232999801635742 y:6.5929999351501465 z:58.65599822998047
        - atom: O x: 6.293000221252441 y:7.327000141143799 z:57.68299865722656
        - atom: CB x: 8.72700023651123 y:6.385000228881836 z:58.63999938964844
        - atom: CG x: 9.965999603271484 y:6.585999965667725 z:59.49399948120117
        - atom: OD1 x: 11.059000015258789 y:6.823999881744385 z:58.986000061035156
        - atom: ND2 x: 9.795000076293945 y:6.491000175476074 z:60.81100082397461
      - residue GLU has 9 atoms
        - atom: N x: 5.109000205993652 y:6.044000148773193 z:59.08000183105469
        - atom: CA x: 3.8510000705718994 y:6.230999946594238 z:58.387001037597656
        - atom: C x: 3.5390000343322754 y:7.684000015258789 z:58.02299880981445
        - atom: O x: 3.0429999828338623 y:7.9670000076293945 z:56.933998107910156
        - atom: CB x: 2.7279999256134033 y:5.677000045776367 z:59.244998931884766
        - atom: CG x: 1.3849999904632568 y:5.681000232696533 z:58.58300018310547
        - atom: CD x: 0.2879999876022339 y:5.394999980926514 z:59.57400131225586
        - atom: OE1 x: 0.3709999918937683 y:4.359000205993652 z:60.27399826049805
        - atom: OE2 x: -0.6549999713897705 y:6.210999965667725 z:59.65399932861328
      - residue ASP has 8 atoms
        - atom: N x: 3.8320000171661377 y:8.607999801635742 z:58.926998138427734
        - atom: CA x: 3.5360000133514404 y:10.008000373840332 z:58.665000915527344
        - atom: C x: 4.449999809265137 y:10.621000289916992 z:57.61399841308594
        - atom: O x: 4.502999782562256 y:11.836999893188477 z:57.472999572753906
        - atom: CB x: 3.615000009536743 y:10.812000274658203 z:59.96900177001953
        - atom: CG x: 5.039000034332275 y:11.223999977111816 z:60.327999114990234
        - atom: OD1 x: 5.9720001220703125 y:10.38599967956543 z:60.19599914550781
        - atom: OD2 x: 5.216000080108643 y:12.392000198364258 z:60.75600051879883
      - residue LYS has 9 atoms
        - atom: N x: 5.159999847412109 y:9.774999618530273 z:56.874000549316406
        - atom: CA x: 6.084000110626221 y:10.223999977111816 z:55.83000183105469
        - atom: C x: 5.663000106811523 y:9.597999572753906 z:54.479000091552734
        - atom: O x: 6.453000068664551 y:9.491999626159668 z:53.529998779296875
        - atom: CB x: 7.515999794006348 y:9.8149995803833 z:56.21200180053711
        - atom: CG x: 8.607000350952148 y:10.362000465393066 z:55.303001403808594
        - atom: CD x: 9.99899959564209 y:9.871000289916992 z:55.709999084472656
        - atom: CE x: 10.60200023651123 y:10.678999900817871 z:56.86199951171875
        - atom: NZ x: 9.82699966430664 y:10.61400032043457 z:58.130001068115234
      - residue LEU has 8 atoms
        - atom: N x: 4.395999908447266 y:9.199000358581543 z:54.41299819946289
        - atom: CA x: 3.8239998817443848 y:8.581000328063965 z:53.22800064086914
        - atom: C x: 2.6070001125335693 y:9.369999885559082 z:52.75899887084961
        - atom: O x: 1.850000023841858 y:9.902000427246094 z:53.573001861572266
        - atom: CB x: 3.36299991607666 y:7.158999919891357 z:53.55099868774414
        - atom: CG x: 4.328999996185303 y:6.171999931335449 z:54.19900131225586
        - atom: CD1 x: 3.621999979019165 y:4.828999996185303 z:54.38100051879883
        - atom: CD2 x: 5.563000202178955 y:6.019000053405762 z:53.32899856567383
      - residue ASN has 8 atoms
        - atom: N x: 2.4019999504089355 y:9.430999755859375 z:51.45000076293945
        - atom: CA x: 1.2419999837875366 y:10.133999824523926 z:50.926998138427734
        - atom: C x: 0.014000000432133675 y:9.26099967956543 z:51.11600112915039
        - atom: O x: 0.12300000339746475 y:8.086999893188477 z:51.41600036621094
        - atom: CB x: 1.4190000295639038 y:10.456000328063965 z:49.446998596191406
        - atom: CG x: 1.8220000267028809 y:9.25100040435791 z:48.641998291015625
        - atom: OD1 x: 1.2480000257492065 y:8.178000450134277 z:48.77899932861328
        - atom: ND2 x: 2.812999963760376 y:9.425999641418457 z:47.790000915527344
      - residue HIS has 10 atoms
        - atom: N x: -1.1540000438690186 y:9.850000381469727 z:50.94499969482422
        - atom: CA x: -2.4070000648498535 y:9.142999649047852 z:51.106998443603516
        - atom: C x: -2.4030001163482666 y:7.800000190734863 z:50.391998291015625
        - atom: O x: -2.8350000381469727 y:6.7829999923706055 z:50.939998626708984
        - atom: CB x: -3.5369999408721924 y:10.003999710083008 z:50.566001892089844
        - atom: CG x: -4.88100004196167 y:9.364999771118164 z:50.6619987487793
        - atom: ND1 x: -5.572999954223633 y:9.265000343322754 z:51.8489990234375
        - atom: CD2 x: -5.666999816894531 y:8.79800033569336 z:49.720001220703125
        - atom: CE1 x: -6.730000019073486 y:8.668000221252441 z:51.6349983215332
        - atom: NE2 x: -6.811999797821045 y:8.37399959564209 z:50.35100173950195
      - residue HIS has 10 atoms
        - atom: N x: -1.8949999809265137 y:7.797999858856201 z:49.17100143432617
        - atom: CA x: -1.8609999418258667 y:6.583000183105469 z:48.375
        - atom: C x: -0.9599999785423279 y:5.51200008392334 z:48.986000061035156
        - atom: O x: -1.3209999799728394 y:4.3420000076293945 z:49.013999938964844
        - atom: CB x: -1.4359999895095825 y:6.927999973297119 z:46.933998107910156
        - atom: CG x: -1.406000018119812 y:5.757999897003174 z:45.99700164794922
        - atom: ND1 x: -1.434999942779541 y:5.908999919891357 z:44.62900161743164
        - atom: CD2 x: -1.2580000162124634 y:4.429999828338623 z:46.2239990234375
        - atom: CE1 x: -1.3009999990463257 y:4.728000164031982 z:44.05400085449219
        - atom: NE2 x: -1.190999984741211 y:3.815000057220459 z:45.000999450683594
      - residue GLN has 9 atoms
        - atom: N x: 0.20800000429153442 y:5.910999774932861 z:49.47100067138672
        - atom: CA x: 1.1390000581741333 y:4.968999862670898 z:50.07500076293945
        - atom: C x: 0.5680000185966492 y:4.394000053405762 z:51.38800048828125
        - atom: O x: 0.800000011920929 y:3.2219998836517334 z:51.69599914550781
        - atom: CB x: 2.499000072479248 y:5.65500020980835 z:50.30099868774414
        - atom: CG x: 3.200000047683716 y:6.076000213623047 z:49.00299835205078
        - atom: CD x: 4.383999824523926 y:7.015999794006348 z:49.22100067138672
        - atom: OE1 x: 4.260000228881836 y:8.043000221252441 z:49.88100051879883
        - atom: NE2 x: 5.531000137329102 y:6.669000148773193 z:48.65399932861328
      - residue ARG has 11 atoms
        - atom: N x: -0.18000000715255737 y:5.201000213623047 z:52.150001525878906
        - atom: CA x: -0.777999997138977 y:4.710000038146973 z:53.39099884033203
        - atom: C x: -1.7100000381469727 y:3.572999954223633 z:53.02399826049805
        - atom: O x: -1.562999963760376 y:2.4649999141693115 z:53.52199935913086
        - atom: CB x: -1.6130000352859497 y:5.7779998779296875 z:54.10200119018555
        - atom: CG x: -0.9010000228881836 y:6.5980000495910645 z:55.172000885009766
        - atom: CD x: -0.2150000035762787 y:7.790999889373779 z:54.56999969482422
        - atom: NE x: 0.1120000034570694 y:8.810999870300293 z:55.56100082397461
        - atom: CZ x: -0.7559999823570251 y:9.329000473022461 z:56.428001403808594
        - atom: NH1 x: -2.0209999084472656 y:8.916000366210938 z:56.444000244140625
        - atom: NH2 x: -0.3630000054836273 y:10.286999702453613 z:57.26100158691406
      - residue ILE has 8 atoms
        - atom: N x: -2.6760001182556152 y:3.8610000610351562 z:52.15399932861328
        - atom: CA x: -3.6410000324249268 y:2.8570001125335693 z:51.694000244140625
        - atom: C x: -2.88700008392334 y:1.61899995803833 z:51.20600128173828
        - atom: O x: -3.2730000019073486 y:0.48100000619888306 z:51.500999450683594
        - atom: CB x: -4.520999908447266 y:3.4000000953674316 z:50.507999420166016
        - atom: CG1 x: -5.324999809265137 y:4.625999927520752 z:50.95399856567383
        - atom: CG2 x: -5.440999984741211 y:2.302999973297119 z:49.98400115966797
        - atom: CD1 x: -6.333000183105469 y:4.361000061035156 z:52.060001373291016
      - residue GLY has 4 atoms
        - atom: N x: -1.8070000410079956 y:1.8609999418258667 z:50.465999603271484
        - atom: CA x: -0.996999979019165 y:0.7850000262260437 z:49.92599868774414
        - atom: C x: -0.5400000214576721 y:-0.16500000655651093 z:51.00400161743164
        - atom: O x: -0.7350000143051147 y:-1.371000051498413 z:50.88600158691406
      - residue LEU has 8 atoms
        - atom: N x: 0.05900000035762787 y:0.4000000059604645 z:52.053001403808594
        - atom: CA x: 0.5699999928474426 y:-0.34200000762939453 z:53.20199966430664
        - atom: C x: -0.5519999861717224 y:-1.0260000228881836 z:53.93899917602539
        - atom: O x: -0.4169999957084656 y:-2.1730000972747803 z:54.332000732421875
        - atom: CB x: 1.2879999876022339 y:0.6060000061988831 z:54.16699981689453
        - atom: CG x: 1.7599999904632568 y:0.08100000023841858 z:55.53300094604492
        - atom: CD1 x: 2.7009999752044678 y:-1.0989999771118164 z:55.36000061035156
        - atom: CD2 x: 2.4820001125335693 y:1.2120000123977661 z:56.27399826049805
      - residue LYS has 9 atoms
        - atom: N x: -1.6549999713897705 y:-0.3050000071525574 z:54.11899948120117
        - atom: CA x: -2.8510000705718994 y:-0.7960000038146973 z:54.805999755859375
        - atom: C x: -3.437999963760376 y:-2.068000078201294 z:54.21099853515625
        - atom: O x: -3.943000078201294 y:-2.9210000038146973 z:54.93199920654297
        - atom: CB x: -3.940000057220459 y:0.2750000059604645 z:54.79199981689453
        - atom: CG x: -5.296000003814697 y:-0.2150000035762787 z:55.270999908447266
        - atom: CD x: -6.254000186920166 y:0.9430000185966492 z:55.45000076293945
        - atom: CE x: -7.507999897003174 y:0.5070000290870667 z:56.176998138427734
        - atom: NZ x: -8.45300006866455 y:1.6299999952316284 z:56.4119987487793
      - residue TYR has 12 atoms
        - atom: N x: -3.3940000534057617 y:-2.177999973297119 z:52.891998291015625
        - atom: CA x: -3.928999900817871 y:-3.3459999561309814 z:52.2140007019043
        - atom: C x: -2.806999921798706 y:-4.0879998207092285 z:51.51499938964844
        - atom: O x: -3.015000104904175 y:-4.678999900817871 z:50.43899917602539
        - atom: CB x: -4.980999946594238 y:-2.921999931335449 z:51.1870002746582
        - atom: CG x: -6.118000030517578 y:-2.1530001163482666 z:51.79399871826172
        - atom: CD1 x: -6.923999786376953 y:-2.7249999046325684 z:52.77000045776367
        - atom: CD2 x: -6.373000144958496 y:-0.8399999737739563 z:51.41600036621094
        - atom: CE1 x: -7.953999996185303 y:-2.003000020980835 z:53.3650016784668
        - atom: CE2 x: -7.40500020980835 y:-0.10899999737739563 z:51.999000549316406
        - atom: CZ x: -8.187999725341797 y:-0.6949999928474426 z:52.97100067138672
        - atom: OH x: -9.218999862670898 y:0.01899999938905239 z:53.53499984741211
      - residue PHE has 11 atoms
        - atom: N x: -1.6200000047683716 y:-4.072000026702881 z:52.117000579833984
        - atom: CA x: -0.4959999918937683 y:-4.738999843597412 z:51.47700119018555
        - atom: C x: -0.7870000004768372 y:-6.201000213623047 z:51.15299987792969
        - atom: O x: -0.6729999780654907 y:-6.626999855041504 z:50.005001068115234
        - atom: CB x: 0.7450000047683716 y:-4.664000034332275 z:52.33300018310547
        - atom: CG x: 1.934000015258789 y:-5.28000020980835 z:51.691001892089844
        - atom: CD1 x: 2.6610000133514404 y:-4.579999923706055 z:50.74100112915039
        - atom: CD2 x: 2.321000099182129 y:-6.566999912261963 z:52.01900100708008
        - atom: CE1 x: 3.7679998874664307 y:-5.1479997634887695 z:50.12099838256836
        - atom: CE2 x: 3.427000045776367 y:-7.1579999923706055 z:51.409000396728516
        - atom: CZ x: 4.156000137329102 y:-6.446000099182129 z:50.45500183105469
      - residue GLY has 4 atoms
        - atom: N x: -1.159999966621399 y:-6.968999862670898 z:52.16699981689453
        - atom: CA x: -1.4630000591278076 y:-8.36299991607666 z:51.941001892089844
        - atom: C x: -2.6440000534057617 y:-8.527000427246094 z:51.00699996948242
        - atom: O x: -2.572000026702881 y:-9.300000190734863 z:50.05500030517578
      - residue ASP has 8 atoms
        - atom: N x: -3.7300000190734863 y:-7.806000232696533 z:51.2760009765625
        - atom: CA x: -4.914000034332275 y:-7.888999938964844 z:50.43600082397461
        - atom: C x: -4.5960001945495605 y:-7.710999965667725 z:48.95600128173828
        - atom: O x: -4.974999904632568 y:-8.550000190734863 z:48.137001037597656
        - atom: CB x: -5.949999809265137 y:-6.8480000495910645 z:50.856998443603516
        - atom: CG x: -6.870999813079834 y:-7.361999988555908 z:51.93000030517578
        - atom: OD1 x: -6.843999862670898 y:-8.590999603271484 z:52.15800094604492
        - atom: OD2 x: -7.624000072479248 y:-6.559999942779541 z:52.5369987487793
      - residue PHE has 11 atoms
        - atom: N x: -3.8889999389648438 y:-6.633999824523926 z:48.61899948120117
        - atom: CA x: -3.5399999618530273 y:-6.348999977111816 z:47.233001708984375
        - atom: C x: -2.683000087738037 y:-7.379000186920166 z:46.516998291015625
        - atom: O x: -2.6549999713897705 y:-7.396999835968018 z:45.290000915527344
        - atom: CB x: -2.8589999675750732 y:-4.974999904632568 z:47.108001708984375
        - atom: CG x: -3.7939999103546143 y:-3.812000036239624 z:47.305999755859375
        - atom: CD1 x: -5.133999824523926 y:-4.020999908447266 z:47.62699890136719
        - atom: CD2 x: -3.3239998817443848 y:-2.5139999389648438 z:47.233001708984375
        - atom: CE1 x: -5.98199987411499 y:-2.9639999866485596 z:47.88100051879883
        - atom: CE2 x: -4.168000221252441 y:-1.437999963760376 z:47.48699951171875
        - atom: CZ x: -5.502999782562256 y:-1.6649999618530273 z:47.814998626708984
      - residue GLU has 9 atoms
        - atom: N x: -1.9630000591278076 y:-8.22700023651123 z:47.244998931884766
        - atom: CA x: -1.1390000581741333 y:-9.21399974822998 z:46.55099868774414
        - atom: C x: -1.9110000133514404 y:-10.48900032043457 z:46.32899856567383
        - atom: O x: -1.409000039100647 y:-11.414999961853027 z:45.70899963378906
        - atom: CB x: 0.16899999976158142 y:-9.505000114440918 z:47.30400085449219
        - atom: CG x: 1.1510000228881836 y:-8.329999923706055 z:47.29899978637695
        - atom: CD x: 2.6040000915527344 y:-8.77299976348877 z:47.356998443603516
        - atom: OE1 x: 2.9189999103546143 y:-9.692000389099121 z:48.141998291015625
        - atom: OE2 x: 3.434000015258789 y:-8.196000099182129 z:46.624000549316406
      - residue LYS has 9 atoms
        - atom: N x: -3.138000011444092 y:-10.534000396728516 z:46.82699966430664
        - atom: CA x: -3.9719998836517334 y:-11.711000442504883 z:46.63999938964844
        - atom: C x: -4.692999839782715 y:-11.647000312805176 z:45.2859992980957
        - atom: O x: -5.2129998207092285 y:-10.595000267028809 z:44.89500045776367
        - atom: CB x: -5.033999919891357 y:-11.817000389099121 z:47.742000579833984
        - atom: CG x: -4.519999980926514 y:-12.019000053405762 z:49.15399932861328
        - atom: CD x: -5.681000232696533 y:-12.40999984741211 z:50.0629997253418
        - atom: CE x: -5.315000057220459 y:-12.395000457763672 z:51.53200149536133
        - atom: NZ x: -4.199999809265137 y:-13.324000358581543 z:51.86800003051758
      - residue ARG has 11 atoms
        - atom: N x: -4.708000183105469 y:-12.767999649047852 z:44.57099914550781
        - atom: CA x: -5.4120001792907715 y:-12.85200023651123 z:43.29800033569336
        - atom: C x: -6.906000137329102 y:-12.857999801635742 z:43.64899826049805
        - atom: O x: -7.281000137329102 y:-13.098999977111816 z:44.79600143432617
        - atom: CB x: -5.052000045776367 y:-14.151000022888184 z:42.57400131225586
        - atom: CG x: -3.5899999141693115 y:-14.277000427246094 z:42.189998626708984
        - atom: CD x: -3.253000020980835 y:-13.343000411987305 z:41.04800033569336
        - atom: NE x: -4.007999897003174 y:-13.678000450134277 z:39.84000015258789
        - atom: CZ x: -4.105000019073486 y:-12.894000053405762 z:38.768001556396484
        - atom: NH1 x: -3.496999979019165 y:-11.711999893188477 z:38.73899841308594
        - atom: NH2 x: -4.809000015258789 y:-13.298999786376953 z:37.71799850463867
      - residue ILE has 8 atoms
        - atom: N x: -7.75600004196167 y:-12.595000267028809 z:42.66600036621094
        - atom: CA x: -9.199000358581543 y:-12.581000328063965 z:42.89099884033203
        - atom: C x: -9.857999801635742 y:-13.762999534606934 z:42.17300033569336
        - atom: O x: -9.720000267028809 y:-13.904000282287598 z:40.957000732421875
        - atom: CB x: -9.817000389099121 y:-11.27400016784668 z:42.358001708984375
        - atom: CG1 x: -9.052000045776367 y:-10.076000213623047 z:42.92499923706055
        - atom: CG2 x: -11.300999641418457 y:-11.206000328063965 z:42.729000091552734
        - atom: CD1 x: -9.505000114440918 y:-8.73900032043457 z:42.39799880981445
      - residue PRO has 7 atoms
        - atom: N x: -10.585000038146973 y:-14.626999855041504 z:42.9119987487793
        - atom: CA x: -11.241999626159668 y:-15.781999588012695 z:42.277000427246094
        - atom: C x: -12.177000045776367 y:-15.265999794006348 z:41.198001861572266
        - atom: O x: -12.9399995803833 y:-14.333000183105469 z:41.44900131225586
        - atom: CB x: -12.015000343322754 y:-16.426000595092773 z:43.42599868774414
        - atom: CG x: -11.246999740600586 y:-15.991999626159668 z:44.65399932861328
        - atom: CD x: -10.90999984741211 y:-14.5600004196167 z:44.3489990234375
      - residue ARG has 11 atoms
        - atom: N x: -12.13700008392334 y:-15.86400032043457 z:40.007999420166016
        - atom: CA x: -12.998000144958496 y:-15.402000427246094 z:38.92300033569336
        - atom: C x: -14.454999923706055 y:-15.329000473022461 z:39.33000183105469
        - atom: O x: -15.230999946594238 y:-14.598999977111816 z:38.73400115966797
        - atom: CB x: -12.876999855041504 y:-16.285999298095703 z:37.683998107910156
        - atom: CG x: -13.494000434875488 y:-15.621000289916992 z:36.470001220703125
        - atom: CD x: -13.788999557495117 y:-16.57900047302246 z:35.345001220703125
        - atom: NE x: -14.845000267028809 y:-16.03700065612793 z:34.49399948120117
        - atom: CZ x: -14.718000411987305 y:-14.97599983215332 z:33.696998596191406
        - atom: NH1 x: -13.567000389099121 y:-14.322999954223633 z:33.61399841308594
        - atom: NH2 x: -15.767000198364258 y:-14.541999816894531 z:33.007999420166016
      - residue GLU has 9 atoms
        - atom: N x: -14.829000473022461 y:-16.084999084472656 z:40.34700012207031
        - atom: CA x: -16.200000762939453 y:-16.082000732421875 z:40.83100128173828
        - atom: C x: -16.530000686645508 y:-14.770999908447266 z:41.529998779296875
        - atom: O x: -17.562000274658203 y:-14.151000022888184 z:41.26499938964844
        - atom: CB x: -16.413999557495117 y:-17.25200080871582 z:41.79399871826172
        - atom: CG x: -17.667999267578125 y:-17.152000427246094 z:42.63999938964844
        - atom: CD x: -18.077999114990234 y:-18.496999740600586 z:43.21699905395508
        - atom: OE1 x: -18.999000549316406 y:-18.52400016784668 z:44.064998626708984
        - atom: OE2 x: -17.48699951171875 y:-19.530000686645508 z:42.816001892089844
      - residue GLU has 9 atoms
        - atom: N x: -15.652999877929688 y:-14.359000205993652 z:42.4370002746582
        - atom: CA x: -15.861000061035156 y:-13.123000144958496 z:43.167999267578125
        - atom: C x: -15.913000106811523 y:-11.949999809265137 z:42.1879997253418
        - atom: O x: -16.642000198364258 y:-10.979999542236328 z:42.409000396728516
        - atom: CB x: -14.75100040435791 y:-12.937999725341797 z:44.20800018310547
        - atom: CG x: -14.975000381469727 y:-13.76099967956543 z:45.46699905395508
        - atom: CD x: -13.857000350952148 y:-13.616000175476074 z:46.49100112915039
        - atom: OE1 x: -13.395000457763672 y:-12.477999687194824 z:46.71699905395508
        - atom: OE2 x: -13.449999809265137 y:-14.640999794006348 z:47.08100128173828
      - residue MET has 8 atoms
        - atom: N x: -15.138999938964844 y:-12.048999786376953 z:41.106998443603516
        - atom: CA x: -15.130000114440918 y:-11.010000228881836 z:40.0890007019043
        - atom: C x: -16.57699966430664 y:-10.881999969482422 z:39.64799880981445
        - atom: O x: -17.172000885009766 y:-9.8100004196167 z:39.71099853515625
        - atom: CB x: -14.267999649047852 y:-11.425999641418457 z:38.893001556396484
        - atom: CG x: -12.784000396728516 y:-11.329000473022461 z:39.141998291015625
        - atom: SD x: -12.277000427246094 y:-9.61400032043457 z:39.38199996948242
        - atom: CE x: -11.970999717712402 y:-9.13599967956543 z:37.689998626708984
      - residue LEU has 8 atoms
        - atom: N x: -17.142000198364258 y:-12.005999565124512 z:39.222999572753906
        - atom: CA x: -18.52199935913086 y:-12.043999671936035 z:38.777000427246094
        - atom: C x: -19.43400001525879 y:-11.295000076293945 z:39.74399948120117
        - atom: O x: -20.256000518798828 y:-10.489999771118164 z:39.3129997253418
        - atom: CB x: -18.979000091552734 y:-13.49899959564209 z:38.625999450683594
        - atom: CG x: -18.22599983215332 y:-14.336000442504883 z:37.57699966430664
        - atom: CD1 x: -18.56999969482422 y:-15.805999755859375 z:37.749000549316406
        - atom: CD2 x: -18.573999404907227 y:-13.864999771118164 z:36.16899871826172
      - residue GLN has 9 atoms
        - atom: N x: -19.2810001373291 y:-11.53499984741211 z:41.04499816894531
        - atom: CA x: -20.1299991607666 y:-10.86299991607666 z:42.040000915527344
        - atom: C x: -19.868999481201172 y:-9.359000205993652 z:42.04899978637695
        - atom: O x: -20.73900032043457 y:-8.557000160217285 z:42.40599822998047
        - atom: CB x: -19.88800048828125 y:-11.430999755859375 z:43.44499969482422
        - atom: CG x: -19.590999603271484 y:-12.925000190734863 z:43.465999603271484
        - atom: CD x: -19.812999725341797 y:-13.557999610900879 z:44.827999114990234
        - atom: OE1 x: -19.44499969482422 y:-14.71399974822998 z:45.05099868774414
        - atom: NE2 x: -20.426000595092773 y:-12.809000015258789 z:45.742000579833984
      - residue MET has 8 atoms
        - atom: N x: -18.6560001373291 y:-8.982999801635742 z:41.66299819946289
        - atom: CA x: -18.284000396728516 y:-7.578999996185303 z:41.612998962402344
        - atom: C x: -18.82900047302246 y:-7.03000020980835 z:40.29999923706055
        - atom: O x: -19.385000228881836 y:-5.929999828338623 z:40.25899887084961
        - atom: CB x: -16.759000778198242 y:-7.435999870300293 z:41.68299865722656
        - atom: CG x: -16.158000946044922 y:-7.941999912261963 z:42.99399948120117
        - atom: SD x: -14.380999565124512 y:-8.246999740600586 z:42.926998138427734
        - atom: CE x: -13.717000007629395 y:-6.666999816894531 z:43.327999114990234
      - residue GLN has 9 atoms
        - atom: N x: -18.690000534057617 y:-7.821000099182129 z:39.236000061035156
        - atom: CA x: -19.16900062561035 y:-7.436999797821045 z:37.9119987487793
        - atom: C x: -20.66699981689453 y:-7.296000003814697 z:37.957000732421875
        - atom: O x: -21.280000686645508 y:-6.793000221252441 z:37.0260009765625
        - atom: CB x: -18.819000244140625 y:-8.5 z:36.875999450683594
        - atom: CG x: -19.424999237060547 y:-8.256999969482422 z:35.5
        - atom: CD x: -19.215999603271484 y:-9.430999755859375 z:34.56100082397461
        - atom: OE1 x: -19.83799934387207 y:-10.493000030517578 z:34.7140007019043
        - atom: NE2 x: -18.32699966430664 y:-9.251999855041504 z:33.58399963378906
      - residue ASP has 8 atoms
        - atom: N x: -21.257999420166016 y:-7.749000072479248 z:39.04999923706055
        - atom: CA x: -22.69499969482422 y:-7.681000232696533 z:39.194000244140625
        - atom: C x: -23.049999237060547 y:-6.394999980926514 z:39.89699935913086
        - atom: O x: -23.94499969482422 y:-5.671999931335449 z:39.46900177001953
        - atom: CB x: -23.18600082397461 y:-8.876999855041504 z:40.00299835205078
        - atom: CG x: -24.58799934387207 y:-9.300999641418457 z:39.630001068115234
        - atom: OD1 x: -25.54599952697754 y:-8.54699993133545 z:39.91600036621094
        - atom: OD2 x: -24.722000122070312 y:-10.397000312805176 z:39.04600143432617
      - residue ILE has 8 atoms
        - atom: N x: -22.33099937438965 y:-6.107999801635742 z:40.97600173950195
        - atom: CA x: -22.56999969482422 y:-4.901000022888184 z:41.7599983215332
        - atom: C x: -22.198999404907227 y:-3.635999917984009 z:40.992000579833984
        - atom: O x: -22.82900047302246 y:-2.5940001010894775 z:41.16600036621094
        - atom: CB x: -21.783000946044922 y:-4.942999839782715 z:43.0989990234375
        - atom: CG1 x: -22.229999542236328 y:-6.1579999923706055 z:43.92100143432617
        - atom: CG2 x: -22.006999969482422 y:-3.6570000648498535 z:43.88999938964844
        - atom: CD1 x: -21.645999908447266 y:-6.208000183105469 z:45.327999114990234
      - residue VAL has 7 atoms
        - atom: N x: -21.18000030517578 y:-3.7290000915527344 z:40.14099884033203
        - atom: CA x: -20.750999450683594 y:-2.5759999752044678 z:39.361000061035156
        - atom: C x: -21.81100082397461 y:-2.3359999656677246 z:38.30500030517578
        - atom: O x: -22.53499984741211 y:-1.3489999771118164 z:38.35900115966797
        - atom: CB x: -19.393999099731445 y:-2.825000047683716 z:38.67300033569336
        - atom: CG1 x: -18.95199966430664 y:-1.5759999752044678 z:37.946998596191406
        - atom: CG2 x: -18.347000122070312 y:-3.2209999561309814 z:39.69900131225586
      - residue LEU has 8 atoms
        - atom: N x: -21.909000396728516 y:-3.263000011444092 z:37.358001708984375
        - atom: CA x: -22.89699935913086 y:-3.177999973297119 z:36.290000915527344
        - atom: C x: -24.26300048828125 y:-2.7330000400543213 z:36.8120002746582
        - atom: O x: -24.941999435424805 y:-1.906000018119812 z:36.19200134277344
        - atom: CB x: -23.040000915527344 y:-4.533999919891357 z:35.59600067138672
        - atom: CG x: -22.295000076293945 y:-4.75 z:34.27399826049805
        - atom: CD1 x: -20.80900001525879 y:-4.521999835968018 z:34.46500015258789
        - atom: CD2 x: -22.566999435424805 y:-6.160999774932861 z:33.75899887084961
      - residue ASN has 8 atoms
        - atom: N x: -24.6560001373291 y:-3.2720000743865967 z:37.96200180053711
        - atom: CA x: -25.947999954223633 y:-2.943000078201294 z:38.551998138427734
        - atom: C x: -26.011999130249023 y:-1.4980000257492065 z:39.018001556396484
        - atom: O x: -26.774999618530273 y:-0.6959999799728394 z:38.49100112915039
        - atom: CB x: -26.240999221801758 y:-3.865999937057495 z:39.736000061035156
        - atom: CG x: -27.707000732421875 y:-3.8570001125335693 z:40.130001068115234
        - atom: OD1 x: -28.28499984741211 y:-2.805999994277954 z:40.42100143432617
        - atom: ND2 x: -28.31800079345703 y:-5.035999774932861 z:40.14099884033203
      - residue GLU has 9 atoms
        - atom: N x: -25.208999633789062 y:-1.1749999523162842 z:40.02000045776367
        - atom: CA x: -25.179000854492188 y:0.16699999570846558 z:40.577999114990234
        - atom: C x: -25.06399917602539 y:1.25 z:39.516998291015625
        - atom: O x: -25.56100082397461 y:2.3570001125335693 z:39.70199966430664
        - atom: CB x: -24.020999908447266 y:0.2759999930858612 z:41.569000244140625
        - atom: CG x: -24.288000106811523 y:-0.4399999976158142 z:42.861000061035156
        - atom: CD x: -25.4689998626709 y:0.15700000524520874 z:43.57600021362305
        - atom: OE1 x: -25.375999450683594 y:1.3259999752044678 z:43.999000549316406
        - atom: OE2 x: -26.4950008392334 y:-0.5339999794960022 z:43.70399856567383
      - residue VAL has 7 atoms
        - atom: N x: -24.398000717163086 y:0.9309999942779541 z:38.41400146484375
        - atom: CA x: -24.229999542236328 y:1.8899999856948853 z:37.33399963378906
        - atom: C x: -25.618999481201172 y:2.247999906539917 z:36.79499816894531
        - atom: O x: -25.95599937438965 y:3.4240000247955322 z:36.630001068115234
        - atom: CB x: -23.381000518798828 y:1.2999999523162842 z:36.17900085449219
        - atom: CG1 x: -23.075000762939453 y:2.36899995803833 z:35.16899871826172
        - atom: CG2 x: -22.10099983215332 y:0.7269999980926514 z:36.702999114990234
      - residue LYS has 9 atoms
        - atom: N x: -26.413999557495117 y:1.215000033378601 z:36.52299880981445
        - atom: CA x: -27.770000457763672 y:1.378000020980835 z:36.016998291015625
        - atom: C x: -28.56100082397461 y:2.3529999256134033 z:36.87699890136719
        - atom: O x: -29.222999572753906 y:3.249000072479248 z:36.358001708984375
        - atom: CB x: -28.500999450683594 y:0.03500000014901161 z:36.00199890136719
        - atom: CG x: -29.937999725341797 y:0.13699999451637268 z:35.51100158691406
        - atom: CD x: -30.6560001373291 y:-1.2070000171661377 z:35.52299880981445
        - atom: CE x: -31.038000106811523 y:-1.6349999904632568 z:36.933998107910156
        - atom: NZ x: -31.767000198364258 y:-2.940999984741211 z:36.91899871826172
      - residue LYS has 9 atoms
        - atom: N x: -28.483999252319336 y:2.1700000762939453 z:38.189998626708984
        - atom: CA x: -29.195999145507812 y:3.01200008392334 z:39.145999908447266
        - atom: C x: -28.899999618530273 y:4.515999794006348 z:39.060001373291016
        - atom: O x: -29.618000030517578 y:5.326000213623047 z:39.63399887084961
        - atom: CB x: -28.916000366210938 y:2.5190000534057617 z:40.564998626708984
        - atom: CG x: -29.30299949645996 y:1.0679999589920044 z:40.792999267578125
        - atom: CD x: -29.030000686645508 y:0.6269999742507935 z:42.22800064086914
        - atom: CE x: -29.3700008392334 y:-0.847000002861023 z:42.40999984741211
        - atom: NZ x: -29.13800048828125 y:-1.3320000171661377 z:43.79899978637695
      - residue VAL has 7 atoms
        - atom: N x: -27.844999313354492 y:4.8979997634887695 z:38.35499954223633
        - atom: CA x: -27.518999099731445 y:6.308000087738037 z:38.22700119018555
        - atom: C x: -28.152000427246094 y:6.7729997634887695 z:36.92399978637695
        - atom: O x: -28.701000213623047 y:7.872000217437744 z:36.827999114990234
        - atom: CB x: -25.989999771118164 y:6.511000156402588 z:38.16600036621094
        - atom: CG1 x: -25.635000228881836 y:7.994999885559082 z:38.32899856567383
        - atom: CG2 x: -25.32699966430664 y:5.671000003814697 z:39.244998931884766
      - residue ASP has 8 atoms
        - atom: N x: -28.059999465942383 y:5.916999816894531 z:35.91699981689453
        - atom: CA x: -28.628000259399414 y:6.202000141143799 z:34.62099838256836
        - atom: C x: -28.538000106811523 y:4.939000129699707 z:33.79800033569336
        - atom: O x: -27.46500015258789 y:4.364999771118164 z:33.65299987792969
        - atom: CB x: -27.874000549316406 y:7.335000038146973 z:33.917999267578125
        - atom: CG x: -28.533000946044922 y:7.744999885559082 z:32.60300064086914
        - atom: OD1 x: -29.73699951171875 y:8.086999893188477 z:32.624000549316406
        - atom: OD2 x: -27.854000091552734 y:7.7210001945495605 z:31.55299949645996
      - residue SER has 6 atoms
        - atom: N x: -29.67799949645996 y:4.511000156402588 z:33.266998291015625
        - atom: CA x: -29.750999450683594 y:3.305000066757202 z:32.45500183105469
        - atom: C x: -29.03700065612793 y:3.424999952316284 z:31.115999221801758
        - atom: O x: -29.08099937438965 y:2.493000030517578 z:30.319000244140625
        - atom: CB x: -31.204999923706055 y:2.9260001182556152 z:32.183998107910156
        - atom: OG x: -31.709999084472656 y:3.6610000133514404 z:31.082000732421875
      - residue GLU has 9 atoms
        - atom: N x: -28.38800048828125 y:4.552000045776367 z:30.847999572753906
        - atom: CA x: -27.687999725341797 y:4.685999870300293 z:29.575000762939453
        - atom: C x: -26.202999114990234 y:4.35099983215332 z:29.645999908447266
        - atom: O x: -25.54199981689453 y:4.173999786376953 z:28.621999740600586
        - atom: CB x: -27.898000717163086 y:6.085999965667725 z:29.003999710083008
        - atom: CG x: -29.305999755859375 y:6.269999980926514 z:28.450000762939453
        - atom: CD x: -29.743999481201172 y:5.085999965667725 z:27.591999053955078
        - atom: OE1 x: -29.18400001525879 y:4.901000022888184 z:26.48900032043457
        - atom: OE2 x: -30.64299964904785 y:4.333000183105469 z:28.02899932861328
      - residue TYR has 12 atoms
        - atom: N x: -25.69300079345703 y:4.261000156402588 z:30.868000030517578
        - atom: CA x: -24.302000045776367 y:3.9110000133514404 z:31.118000030517578
        - atom: C x: -24.009000778198242 y:2.4860000610351562 z:30.6299991607666
        - atom: O x: -24.80500030517578 y:1.5779999494552612 z:30.854000091552734
        - atom: CB x: -24.033000946044922 y:3.9600000381469727 z:32.612998962402344
        - atom: CG x: -23.69300079345703 y:5.311999797821045 z:33.18600082397461
        - atom: CD1 x: -22.573999404907227 y:6.00600004196167 z:32.75400161743164
        - atom: CD2 x: -24.45400047302246 y:5.866000175476074 z:34.209999084472656
        - atom: CE1 x: -22.222999572753906 y:7.206999778747559 z:33.33100128173828
        - atom: CE2 x: -24.111000061035156 y:7.065999984741211 z:34.78499984741211
        - atom: CZ x: -22.993999481201172 y:7.724999904632568 z:34.340999603271484
        - atom: OH x: -22.635000228881836 y:8.914999961853027 z:34.90700149536133
      - residue ILE has 8 atoms
        - atom: N x: -22.875 y:2.2880001068115234 z:29.96299934387207
        - atom: CA x: -22.486000061035156 y:0.9539999961853027 z:29.506000518798828
        - atom: C x: -21.17099952697754 y:0.5669999718666077 z:30.18600082397461
        - atom: O x: -20.097000122070312 y:0.6959999799728394 z:29.594999313354492
        - atom: CB x: -22.257999420166016 y:0.8889999985694885 z:27.974000930786133
        - atom: CG1 x: -23.577999114990234 y:1.0160000324249268 z:27.23200035095215
        - atom: CG2 x: -21.613000869750977 y:-0.45100000500679016 z:27.584999084472656
        - atom: CD1 x: -23.41699981689453 y:0.8740000128746033 z:25.736000061035156
      - residue ALA has 5 atoms
        - atom: N x: -21.249000549316406 y:0.10000000149011612 z:31.42799949645996
        - atom: CA x: -20.040000915527344 y:-0.296999990940094 z:32.15399932861328
        - atom: C x: -19.613000869750977 y:-1.6979999542236328 z:31.74799919128418
        - atom: O x: -20.31399917602539 y:-2.6679999828338623 z:32.02799987792969
        - atom: CB x: -20.28700065612793 y:-0.24199999868869781 z:33.65700149536133
      - residue THR has 7 atoms
        - atom: N x: -18.457000732421875 y:-1.7899999618530273 z:31.097999572753906
        - atom: CA x: -17.916000366210938 y:-3.066999912261963 z:30.64299964904785
        - atom: C x: -16.632999420166016 y:-3.4679999351501465 z:31.371000289916992
        - atom: O x: -15.590999603271484 y:-2.819999933242798 z:31.200000762939453
        - atom: CB x: -17.61199951171875 y:-3.0190000534057617 z:29.134000778198242
        - atom: OG1 x: -18.81399917602539 y:-2.7090001106262207 z:28.420000076293945
        - atom: CG2 x: -17.062000274658203 y:-4.354000091552734 z:28.64299964904785
      - residue VAL has 7 atoms
        - atom: N x: -16.701000213623047 y:-4.531000137329102 z:32.178001403808594
        - atom: CA x: -15.51200008392334 y:-5.008999824523926 z:32.893001556396484
        - atom: C x: -14.501999855041504 y:-5.539999961853027 z:31.885000228881836
        - atom: O x: -14.866999626159668 y:-6.291999816894531 z:31.0
        - atom: CB x: -15.82800006866455 y:-6.168000221252441 z:33.861000061035156
        - atom: CG1 x: -14.53499984741211 y:-6.660999774932861 z:34.49399948120117
        - atom: CG2 x: -16.80299949645996 y:-5.7170000076293945 z:34.933998107910156
      - residue CYS has 6 atoms
        - atom: N x: -13.236000061035156 y:-5.158999919891357 z:32.01599884033203
        - atom: CA x: -12.208000183105469 y:-5.639999866485596 z:31.089000701904297
        - atom: C x: -10.972000122070312 y:-6.2220001220703125 z:31.773000717163086
        - atom: O x: -11.039999961853027 y:-6.798999786376953 z:32.85300064086914
        - atom: CB x: -11.751999855041504 y:-4.51800012588501 z:30.163000106811523
        - atom: SG x: -13.08899974822998 y:-3.6470000743865967 z:29.341999053955078
      - residue GLY has 4 atoms
        - atom: N x: -9.829999923706055 y:-6.051000118255615 z:31.124000549316406
        - atom: CA x: -8.604000091552734 y:-6.572999954223633 z:31.680999755859375
        - atom: C x: -8.550999641418457 y:-8.071999549865723 z:31.476999282836914
        - atom: O x: -9.340999603271484 y:-8.630000114440918 z:30.722000122070312
      - residue SER has 6 atoms
        - atom: N x: -7.61899995803833 y:-8.729999542236328 z:32.15399932861328
        - atom: CA x: -7.484000205993652 y:-10.166000366210938 z:32.025001525878906
        - atom: C x: -8.803000450134277 y:-10.85200023651123 z:32.362998962402344
        - atom: O x: -8.97700023651123 y:-12.031000137329102 z:32.077999114990234
        - atom: CB x: -6.353000164031982 y:-10.680999755859375 z:32.926998138427734
        - atom: OG x: -6.578000068664551 y:-10.366000175476074 z:34.28799819946289
      - residue PHE has 11 atoms
        - atom: N x: -9.734999656677246 y:-10.123000144958496 z:32.96799850463867
        - atom: CA x: -11.02400016784668 y:-10.720999717712402 z:33.28300094604492
        - atom: C x: -11.821999549865723 y:-10.930999755859375 z:32.000999450683594
        - atom: O x: -12.414999961853027 y:-11.984999656677246 z:31.797000885009766
        - atom: CB x: -11.848999977111816 y:-9.84000015258789 z:34.20500183105469
        - atom: CG x: -13.270000457763672 y:-10.277000427246094 z:34.305999755859375
        - atom: CD1 x: -13.663000106811523 y:-11.180000305175781 z:35.28200149536133
        - atom: CD2 x: -14.206999778747559 y:-9.845999717712402 z:33.369998931884766
        - atom: CE1 x: -14.968000411987305 y:-11.656000137329102 z:35.32699966430664
        - atom: CE2 x: -15.517999649047852 y:-10.312000274658203 z:33.39799880981445
        - atom: CZ x: -15.902999877929688 y:-11.220999717712402 z:34.37900161743164
      - residue ARG has 11 atoms
        - atom: N x: -11.862000465393066 y:-9.913000106811523 z:31.148000717163086
        - atom: CA x: -12.595000267028809 y:-10.017999649047852 z:29.895000457763672
        - atom: C x: -11.9350004196167 y:-11.093999862670898 z:29.05299949645996
        - atom: O x: -12.581999778747559 y:-11.767000198364258 z:28.249000549316406
        - atom: CB x: -12.574000358581543 y:-8.678999900817871 z:29.16200065612793
        - atom: CG x: -13.28499984741211 y:-8.682000160217285 z:27.829999923706055
        - atom: CD x: -14.185999870300293 y:-7.460000038146973 z:27.68899917602539
        - atom: NE x: -14.734000205993652 y:-7.388000011444092 z:26.347000122070312
        - atom: CZ x: -13.996999740600586 y:-7.210000038146973 z:25.257999420166016
        - atom: NH1 x: -12.6850004196167 y:-7.070000171661377 z:25.35300064086914
        - atom: NH2 x: -14.567999839782715 y:-7.215000152587891 z:24.062999725341797
      - residue ARG has 11 atoms
        - atom: N x: -10.635000228881836 y:-11.258999824523926 z:29.259000778198242
        - atom: CA x: -9.885000228881836 y:-12.258999824523926 z:28.534000396728516
        - atom: C x: -10.24899959564209 y:-13.630999565124512 z:29.086000442504883
        - atom: O x: -9.66100025177002 y:-14.633999824523926 z:28.714000701904297
        - atom: CB x: -8.387999534606934 y:-12.006999969482422 z:28.687999725341797
        - atom: CG x: -7.964000225067139 y:-10.605999946594238 z:28.301000595092773
        - atom: CD x: -6.538000106811523 y:-10.583000183105469 z:27.792999267578125
        - atom: NE x: -5.581999778747559 y:-11.0600004196167 z:28.784000396728516
        - atom: CZ x: -5.169000148773193 y:-10.347000122070312 z:29.82200050354004
        - atom: NH1 x: -5.623000144958496 y:-9.119000434875488 z:30.011999130249023
        - atom: NH2 x: -4.296000003814697 y:-10.855999946594238 z:30.66900062561035
      - residue GLY has 4 atoms
        - atom: N x: -11.241999626159668 y:-13.666000366210938 z:29.965999603271484
        - atom: CA x: -11.654000282287598 y:-14.925000190734863 z:30.55900001525879
        - atom: C x: -10.503999710083008 y:-15.541999816894531 z:31.332000732421875
        - atom: O x: -9.788000106811523 y:-16.39900016784668 z:30.81100082397461
      - residue ALA has 5 atoms
        - atom: N x: -10.319000244140625 y:-15.102999687194824 z:32.573001861572266
        - atom: CA x: -9.23900032043457 y:-15.609000205993652 z:33.4109992980957
        - atom: C x: -9.798999786376953 y:-16.110000610351562 z:34.7239990234375
        - atom: O x: -10.76099967956543 y:-15.543999671936035 z:35.250999450683594
        - atom: CB x: -8.211999893188477 y:-14.51099967956543 z:33.6619987487793
      - residue GLU has 9 atoms
        - atom: N x: -9.192999839782715 y:-17.165000915527344 z:35.25699996948242
        - atom: CA x: -9.666000366210938 y:-17.74799919128418 z:36.512001037597656
        - atom: C x: -9.555000305175781 y:-16.80900001525879 z:37.69599914550781
        - atom: O x: -10.270000457763672 y:-16.94700050354004 z:38.68600082397461
        - atom: CB x: -8.932000160217285 y:-19.05900001525879 z:36.80099868774414
        - atom: CG x: -9.420000076293945 y:-20.18199920654297 z:35.91999816894531
        - atom: CD x: -10.944999694824219 y:-20.224000930786133 z:35.84400177001953
        - atom: OE1 x: -11.60200023651123 y:-20.437999725341797 z:36.89699935913086
        - atom: OE2 x: -11.484999656677246 y:-20.034000396728516 z:34.72700119018555
      - residue SER has 6 atoms
        - atom: N x: -8.654999732971191 y:-15.845999717712402 z:37.58000183105469
        - atom: CA x: -8.458000183105469 y:-14.861000061035156 z:38.625999450683594
        - atom: C x: -7.815999984741211 y:-13.618000030517578 z:38.0099983215332
        - atom: O x: -7.223999977111816 y:-13.684000015258789 z:36.92599868774414
        - atom: CB x: -7.578000068664551 y:-15.440999984741211 z:39.744998931884766
        - atom: OG x: -6.326000213623047 y:-15.878999710083008 z:39.25
      - residue SER has 6 atoms
        - atom: N x: -7.935999870300293 y:-12.489999771118164 z:38.70100021362305
        - atom: CA x: -7.374000072479248 y:-11.253000259399414 z:38.196998596191406
        - atom: C x: -6.690999984741211 y:-10.42300033569336 z:39.26900100708008
        - atom: O x: -7.107999801635742 y:-10.406000137329102 z:40.42399978637695
        - atom: CB x: -8.47599983215332 y:-10.42199993133545 z:37.54199981689453
        - atom: OG x: -9.085000038146973 y:-11.130999565124512 z:36.481998443603516
      - residue GLY has 4 atoms
        - atom: N x: -5.633999824523926 y:-9.72700023651123 z:38.882999420166016
        - atom: CA x: -4.954999923706055 y:-8.890999794006348 z:39.84299850463867
        - atom: C x: -5.926000118255615 y:-7.854000091552734 z:40.37900161743164
        - atom: O x: -5.889999866485596 y:-7.50600004196167 z:41.551998138427734
      - residue ASP has 8 atoms
        - atom: N x: -6.810999870300293 y:-7.369999885559082 z:39.51900100708008
        - atom: CA x: -7.783999919891357 y:-6.349999904632568 z:39.9119987487793
        - atom: C x: -9.005000114440918 y:-6.341000080108643 z:38.992000579833984
        - atom: O x: -9.175000190734863 y:-7.230999946594238 z:38.16699981689453
        - atom: CB x: -7.130000114440918 y:-4.9670000076293945 z:39.8650016784668
        - atom: CG x: -6.76800012588501 y:-4.546000003814697 z:38.452999114990234
        - atom: OD1 x: -6.9720001220703125 y:-5.339000225067139 z:37.50899887084961
        - atom: OD2 x: -6.2779998779296875 y:-3.4170000553131104 z:38.27899932861328
      - residue MET has 8 atoms
        - atom: N x: -9.845999717712402 y:-5.321000099182129 z:39.1510009765625
        - atom: CA x: -11.045000076293945 y:-5.1479997634887695 z:38.334999084472656
        - atom: C x: -10.956000328063965 y:-3.8489999771118164 z:37.55500030517578
        - atom: O x: -10.967000007629395 y:-2.7790000438690186 z:38.13800048828125
        - atom: CB x: -12.298999786376953 y:-5.109000205993652 z:39.194000244140625
        - atom: CG x: -13.512999534606934 y:-4.709000110626221 z:38.38399887084961
        - atom: SD x: -15.081000328063965 y:-5.085999965667725 z:39.16600036621094
        - atom: CE x: -15.109999656677246 y:-6.809000015258789 z:38.875
      - residue ASP has 8 atoms
        - atom: N x: -10.873000144958496 y:-3.950000047683716 z:36.23500061035156
        - atom: CA x: -10.781000137329102 y:-2.7780001163482666 z:35.367000579833984
        - atom: C x: -12.133000373840332 y:-2.5320000648498535 z:34.70500183105469
        - atom: O x: -12.66100025177002 y:-3.4049999713897705 z:34.04100036621094
        - atom: CB x: -9.710000038146973 y:-3.0380001068115234 z:34.321998596191406
        - atom: CG x: -8.418999671936035 y:-3.5199999809265137 z:34.94300079345703
        - atom: OD1 x: -7.6579999923706055 y:-2.6649999618530273 z:35.45100021362305
        - atom: OD2 x: -8.175999641418457 y:-4.752999782562256 z:34.95899963378906
      - residue VAL has 7 atoms
        - atom: N x: -12.694000244140625 y:-1.3459999561309814 z:34.887001037597656
        - atom: CA x: -13.998000144958496 y:-1.0369999408721924 z:34.314998626708984
        - atom: C x: -13.968999862670898 y:0.0860000029206276 z:33.28300094604492
        - atom: O x: -13.496000289916992 y:1.1820000410079956 z:33.5629997253418
        - atom: CB x: -14.99899959564209 y:-0.6549999713897705 z:35.433998107910156
        - atom: CG1 x: -16.375 y:-0.4050000011920929 z:34.85599899291992
        - atom: CG2 x: -15.0649995803833 y:-1.7660000324249268 z:36.45800018310547
      - residue LEU has 8 atoms
        - atom: N x: -14.458000183105469 y:-0.19699999690055847 z:32.082000732421875
        - atom: CA x: -14.527999877929688 y:0.8050000071525574 z:31.0310001373291
        - atom: C x: -15.949999809265137 y:1.3270000219345093 z:31.106000900268555
        - atom: O x: -16.90399932861328 y:0.5569999814033508 z:31.158000946044922
        - atom: CB x: -14.281000137329102 y:0.19300000369548798 z:29.663999557495117
        - atom: CG x: -14.069000244140625 y:1.2020000219345093 z:28.530000686645508
        - atom: CD1 x: -12.979000091552734 y:2.184999942779541 z:28.922000885009766
        - atom: CD2 x: -13.649999618530273 y:0.48399999737739563 z:27.270000457763672
      - residue LEU has 8 atoms
        - atom: N x: -16.086999893188477 y:2.640000104904175 z:31.107999801635742
        - atom: CA x: -17.38800048828125 y:3.260999917984009 z:31.239999771118164
        - atom: C x: -17.714000701904297 y:4.26200008392334 z:30.121999740600586
        - atom: O x: -16.847000122070312 y:5.017000198364258 z:29.67799949645996
        - atom: CB x: -17.423999786376953 y:3.9570000171661377 z:32.59700012207031
        - atom: CG x: -18.70199966430664 y:4.685999870300293 z:32.948001861572266
        - atom: CD1 x: -19.889999389648438 y:3.7049999237060547 z:32.92599868774414
        - atom: CD2 x: -18.520000457763672 y:5.311999797821045 z:34.292999267578125
      - residue THR has 7 atoms
        - atom: N x: -18.966999053955078 y:4.270999908447266 z:29.67099952697754
        - atom: CA x: -19.382999420166016 y:5.206999778747559 z:28.621999740600586
        - atom: C x: -20.781999588012695 y:5.7170000076293945 z:28.87299919128418
        - atom: O x: -21.530000686645508 y:5.166999816894531 z:29.683000564575195
        - atom: CB x: -19.409000396728516 y:4.563000202178955 z:27.23900032043457
        - atom: OG1 x: -20.46500015258789 y:3.6029999256134033 z:27.19499969482422
        - atom: CG2 x: -18.097000122070312 y:3.871000051498413 z:26.937999725341797
      - residue HIS has 10 atoms
        - atom: N x: -21.13599967956543 y:6.7769999504089355 z:28.163999557495117
        - atom: CA x: -22.46500015258789 y:7.359000205993652 z:28.28700065612793
        - atom: C x: -22.768999099731445 y:8.1899995803833 z:27.04800033569336
        - atom: O x: -21.88599967956543 y:8.836999893188477 z:26.488000869750977
        - atom: CB x: -22.566999435424805 y:8.227999687194824 z:29.542999267578125
        - atom: CG x: -23.91200065612793 y:8.859999656677246 z:29.735000610351562
        - atom: ND1 x: -24.489999771118164 y:9.684000015258789 z:28.79199981689453
        - atom: CD2 x: -24.777999877929688 y:8.817000389099121 z:30.777000427246094
        - atom: CE1 x: -25.650999069213867 y:10.123000144958496 z:29.243999481201172
        - atom: NE2 x: -25.850000381469727 y:9.612000465393066 z:30.44700050354004
      - residue PRO has 7 atoms
        - atom: N x: -24.027999877929688 y:8.15999984741211 z:26.590999603271484
        - atom: CA x: -24.441999435424805 y:8.918999671936035 z:25.409000396728516
        - atom: C x: -24.042999267578125 y:10.402999877929688 z:25.429000854492188
        - atom: O x: -23.601999282836914 y:10.946000099182129 z:24.416000366210938
        - atom: CB x: -25.95199966430664 y:8.711999893188477 z:25.395999908447266
        - atom: CG x: -26.070999145507812 y:7.288000106811523 z:25.88599967956543
        - atom: CD x: -25.117000579833984 y:7.2789998054504395 z:27.059999465942383
      - residue SER has 6 atoms
        - atom: N x: -24.176000595092773 y:11.045000076293945 z:26.583999633789062
        - atom: CA x: -23.854000091552734 y:12.461999893188477 z:26.711000442504883
        - atom: C x: -22.368000030517578 y:12.763999938964844 z:26.673999786376953
        - atom: O x: -21.957000732421875 y:13.888999938964844 z:26.972999572753906
        - atom: CB x: -24.410999298095703 y:13.015000343322754 z:28.018999099731445
        - atom: OG x: -23.520000457763672 y:12.762999534606934 z:29.091999053955078
      - residue PHE has 11 atoms
        - atom: N x: -21.558000564575195 y:11.779999732971191 z:26.30699920654297
        - atom: CA x: -20.12299919128418 y:11.99899959564209 z:26.285999298095703
        - atom: C x: -19.398000717163086 y:11.35200023651123 z:25.132999420166016
        - atom: O x: -19.242000579833984 y:10.137999534606934 z:25.084999084472656
        - atom: CB x: -19.506000518798828 y:11.520999908447266 z:27.60099983215332
        - atom: CG x: -18.007999420166016 y:11.626999855041504 z:27.636999130249023
        - atom: CD1 x: -17.367000579833984 y:12.77299976348877 z:27.167999267578125
        - atom: CD2 x: -17.236000061035156 y:10.593999862670898 z:28.156999588012695
        - atom: CE1 x: -15.989999771118164 y:12.890000343322754 z:27.218000411987305
        - atom: CE2 x: -15.854999542236328 y:10.704000473022461 z:28.211000442504883
        - atom: CZ x: -15.229999542236328 y:11.857000350952148 z:27.739999771118164
      - residue THR has 7 atoms
        - atom: N x: -18.934999465942383 y:12.182999610900879 z:24.211000442504883
        - atom: CA x: -18.201000213623047 y:11.710000038146973 z:23.042999267578125
        - atom: C x: -17.07200050354004 y:12.701000213623047 z:22.77400016784668
        - atom: O x: -16.788000106811523 y:13.565999984741211 z:23.59600067138672
        - atom: CB x: -19.110000610351562 y:11.645999908447266 z:21.799999237060547
        - atom: OG1 x: -19.204999923706055 y:12.947999954223633 z:21.209999084472656
        - atom: CG2 x: -20.5049991607666 y:11.180000305175781 z:22.18400001525879
      - residue SER has 6 atoms
        - atom: N x: -16.42799949645996 y:12.579000473022461 z:21.625999450683594
        - atom: CA x: -15.345999717712402 y:13.48900032043457 z:21.288000106811523
        - atom: C x: -15.72700023651123 y:14.932999610900879 z:21.63599967956543
        - atom: O x: -15.057999610900879 y:15.576000213623047 z:22.45199966430664
        - atom: CB x: -15.020000457763672 y:13.368000030517578 z:19.798999786376953
        - atom: OG x: -14.71500015258789 y:12.024999618530273 z:19.464000701904297
      - residue GLU has 9 atoms
        - atom: N x: -16.80699920654297 y:15.42199993133545 z:21.023000717163086
        - atom: CA x: -17.32900047302246 y:16.783000946044922 z:21.238000869750977
        - atom: C x: -17.645000457763672 y:17.051000595092773 z:22.7189998626709
        - atom: O x: -16.93400001525879 y:17.798999786376953 z:23.395999908447266
        - atom: CB x: -18.590999603271484 y:16.97100067138672 z:20.389999389648438
        - atom: CG x: -19.5049991607666 y:15.744000434875488 z:20.41900062561035
        - atom: CD x: -20.75200080871582 y:15.880999565124512 z:19.555999755859375
        - atom: OE1 x: -20.6200008392334 y:16.08300018310547 z:18.32900047302246
        - atom: OE2 x: -21.8700008392334 y:15.776000022888184 z:20.10700035095215
      - residue SER has 6 atoms
        - atom: N x: -18.738000869750977 y:16.454999923706055 z:23.19099998474121
        - atom: CA x: -19.179000854492188 y:16.530000686645508 z:24.583999633789062
        - atom: C x: -19.48200035095215 y:17.86400032043457 z:25.290000915527344
        - atom: O x: -20.475000381469727 y:17.961999893188477 z:26.020999908447266
        - atom: CB x: -18.18199920654297 y:15.746000289916992 z:25.451000213623047
        - atom: OG x: -16.867000579833984 y:16.288999557495117 z:25.367000579833984
      - residue THR has 7 atoms
        - atom: N x: -18.636999130249023 y:18.87299919128418 z:25.0939998626709
        - atom: CA x: -18.801000595092773 y:20.159000396728516 z:25.781999588012695
        - atom: C x: -18.413999557495117 y:19.841999053955078 z:27.225000381469727
        - atom: O x: -18.558000564575195 y:20.67099952697754 z:28.12700080871582
        - atom: CB x: -20.27400016784668 y:20.67799949645996 z:25.78700065612793
        - atom: OG1 x: -20.80299949645996 y:20.674999237060547 z:24.45400047302246
        - atom: CG2 x: -20.33799934387207 y:22.104999542236328 z:26.34600067138672
      - residue LYS has 9 atoms
        - atom: N x: -17.930999755859375 y:18.615999221801758 z:27.42099952697754
        - atom: CA x: -17.509000778198242 y:18.101999282836914 z:28.725000381469727
        - atom: C x: -18.625 y:18.062000274658203 z:29.767000198364258
        - atom: O x: -19.027000427246094 y:19.090999603271484 z:30.31800079345703
        - atom: CB x: -16.312000274658203 y:18.898000717163086 z:29.25200080871582
        - atom: CG x: -14.979999542236328 y:18.506999969482422 z:28.608999252319336
        - atom: CD x: -14.986000061035156 y:18.663999557495117 z:27.079999923706055
        - atom: CE x: -13.618000030517578 y:18.32900047302246 z:26.48699951171875
        - atom: NZ x: -13.541999816894531 y:18.54800033569336 z:25.016000747680664
      - residue GLN has 9 atoms
        - atom: N x: -19.118999481201172 y:16.850000381469727 z:30.014999389648438
        - atom: CA x: -20.18400001525879 y:16.606000900268555 z:30.979000091552734
        - atom: C x: -19.53700065612793 y:16.427000045776367 z:32.35100173950195
        - atom: O x: -18.87299919128418 y:15.42199993133545 z:32.61600112915039
        - atom: CB x: -20.966999053955078 y:15.35099983215332 z:30.586000442504883
        - atom: CG x: -22.29400062561035 y:15.206999778747559 z:31.299999237060547
        - atom: CD x: -23.20400047302246 y:16.392000198364258 z:31.062000274658203
        - atom: OE1 x: -23.5310001373291 y:16.709999084472656 z:29.92300033569336
        - atom: NE2 x: -23.618000030517578 y:17.05500030517578 z:32.137001037597656
      - residue PRO has 7 atoms
        - atom: N x: -19.719999313354492 y:17.417999267578125 z:33.23699951171875
        - atom: CA x: -19.187000274658203 y:17.464000701904297 z:34.60200119018555
        - atom: C x: -19.802000045776367 y:16.465999603271484 z:35.58100128173828
        - atom: O x: -20.979000091552734 y:16.569000244140625 z:35.93000030517578
        - atom: CB x: -19.45400047302246 y:18.90399932861328 z:35.012001037597656
        - atom: CG x: -20.766000747680664 y:19.173999786376953 z:34.35300064086914
        - atom: CD x: -20.55299949645996 y:18.604999542236328 z:32.970001220703125
      - residue LYS has 9 atoms
        - atom: N x: -18.98699951171875 y:15.51099967956543 z:36.02000045776367
        - atom: CA x: -19.39900016784668 y:14.482000350952148 z:36.97200012207031
        - atom: C x: -20.075000762939453 y:13.255000114440918 z:36.362998962402344
        - atom: O x: -20.964000701904297 y:12.654999732971191 z:36.9739990234375
        - atom: CB x: -20.297000885009766 y:15.085000038146973 z:38.06100082397461
        - atom: CG x: -19.63599967956543 y:16.225000381469727 z:38.82099914550781
        - atom: CD x: -20.55299949645996 y:16.827999114990234 z:39.87300109863281
        - atom: CE x: -19.891000747680664 y:18.023000717163086 z:40.55099868774414
        - atom: NZ x: -20.739999771118164 y:18.586000442504883 z:41.63999938964844
      - residue LEU has 8 atoms
        - atom: N x: -19.663999557495117 y:12.876999855041504 z:35.15700149536133
        - atom: CA x: -20.231000900268555 y:11.685999870300293 z:34.54800033569336
        - atom: C x: -19.660999298095703 y:10.541000366210938 z:35.36899948120117
        - atom: O x: -20.357999801635742 y:9.57800006866455 z:35.69499969482422
        - atom: CB x: -19.77899932861328 y:11.529000282287598 z:33.09600067138672
        - atom: CG x: -20.839000701904297 y:11.605999946594238 z:31.996999740600586
        - atom: CD1 x: -20.340999603271484 y:10.803999900817871 z:30.812000274658203
        - atom: CD2 x: -22.187000274658203 y:11.057000160217285 z:32.479000091552734
      - residue LEU has 8 atoms
        - atom: N x: -18.3799991607666 y:10.666000366210938 z:35.709999084472656
        - atom: CA x: -17.700000762939453 y:9.656000137329102 z:36.494998931884766
        - atom: C x: -17.95599937438965 y:9.869999885559082 z:37.96799850463867
        - atom: O x: -18.058000564575195 y:8.918999671936035 z:38.729000091552734
        - atom: CB x: -16.20400047302246 y:9.694000244140625 z:36.222999572753906
        - atom: CG x: -15.364999771118164 y:8.619000434875488 z:36.91600036621094
        - atom: CD1 x: -15.930000305175781 y:7.230999946594238 z:36.617000579833984
        - atom: CD2 x: -13.913000106811523 y:8.743000030517578 z:36.44200134277344
      - residue HIS has 10 atoms
        - atom: N x: -18.06999969482422 y:11.121999740600586 z:38.37699890136719
        - atom: CA x: -18.312000274658203 y:11.401000022888184 z:39.779998779296875
        - atom: C x: -19.5310001373291 y:10.654999732971191 z:40.31700134277344
        - atom: O x: -19.44099998474121 y:9.95300006866455 z:41.316001892089844
        - atom: CB x: -18.496999740600586 y:12.901000022888184 z:40.000999450683594
        - atom: CG x: -18.812000274658203 y:13.258999824523926 z:41.41999816894531
        - atom: ND1 x: -17.89900016784668 y:13.11299991607666 z:42.44200134277344
        - atom: CD2 x: -19.959999084472656 y:13.682999610900879 z:41.99700164794922
        - atom: CE1 x: -18.474000930786133 y:13.425000190734863 z:43.59000015258789
        - atom: NE2 x: -19.725000381469727 y:13.77400016784668 z:43.347999572753906
      - residue GLN has 9 atoms
        - atom: N x: -20.66900062561035 y:10.812999725341797 z:39.64699935913086
        - atom: CA x: -21.92300033569336 y:10.175999641418457 z:40.055999755859375
        - atom: C x: -21.83099937438965 y:8.678000450134277 z:40.29800033569336
        - atom: O x: -22.37700080871582 y:8.17300033569336 z:41.268001556396484
        - atom: CB x: -23.016000747680664 y:10.432000160217285 z:39.018001556396484
        - atom: CG x: -23.368000030517578 y:11.890999794006348 z:38.82099914550781
        - atom: CD x: -24.46299934387207 y:12.07699966430664 z:37.78099822998047
        - atom: OE1 x: -25.597999572753906 y:11.62600040435791 z:37.9640007019043
        - atom: NE2 x: -24.124000549316406 y:12.73799991607666 z:36.67900085449219
      - residue VAL has 7 atoms
        - atom: N x: -21.155000686645508 y:7.968999862670898 z:39.409000396728516
        - atom: CA x: -21.006000518798828 y:6.53000020980835 z:39.54600143432617
        - atom: C x: -20.003000259399414 y:6.197000026702881 z:40.6510009765625
        - atom: O x: -20.218000411987305 y:5.28000020980835 z:41.4379997253418
        - atom: CB x: -20.562999725341797 y:5.888000011444092 z:38.20899963378906
        - atom: CG1 x: -20.05699920654297 y:4.473999977111816 z:38.441001892089844
        - atom: CG2 x: -21.73699951171875 y:5.868000030517578 z:37.24599838256836
      - residue VAL has 7 atoms
        - atom: N x: -18.913999557495117 y:6.947000026702881 z:40.720001220703125
        - atom: CA x: -17.933000564575195 y:6.690000057220459 z:41.75199890136719
        - atom: C x: -18.690000534057617 y:6.857999801635742 z:43.042999267578125
        - atom: O x: -18.660999298095703 y:6.008999824523926 z:43.92399978637695
        - atom: CB x: -16.781999588012695 y:7.709000110626221 z:41.72200012207031
        - atom: CG1 x: -15.850000381469727 y:7.456999778747559 z:42.880001068115234
        - atom: CG2 x: -16.020000457763672 y:7.6020002365112305 z:40.41999816894531
      - residue GLU has 9 atoms
        - atom: N x: -19.398000717163086 y:7.968999862670898 z:43.132999420166016
        - atom: CA x: -20.167999267578125 y:8.276000022888184 z:44.319000244140625
        - atom: C x: -21.114999771118164 y:7.140999794006348 z:44.65999984741211
        - atom: O x: -21.065000534057617 y:6.604000091552734 z:45.75699996948242
        - atom: CB x: -20.961000442504883 y:9.5600004196167 z:44.09700012207031
        - atom: CG x: -21.607999801635742 y:10.109999656677246 z:45.33399963378906
        - atom: CD x: -22.40399932861328 y:11.36299991607666 z:45.042999267578125
        - atom: OE1 x: -23.4689998626709 y:11.255999565124512 z:44.395999908447266
        - atom: OE2 x: -21.961999893188477 y:12.458000183105469 z:45.452999114990234
      - residue GLN has 9 atoms
        - atom: N x: -21.9689998626709 y:6.763000011444092 z:43.715999603271484
        - atom: CA x: -22.940000534057617 y:5.702000141143799 z:43.96500015258789
        - atom: C x: -22.292999267578125 y:4.389999866485596 z:44.44900131225586
        - atom: O x: -22.858999252319336 y:3.684000015258789 z:45.28799819946289
        - atom: CB x: -23.791000366210938 y:5.4720001220703125 z:42.70100021362305
        - atom: CG x: -24.867000579833984 y:4.372000217437744 z:42.79600143432617
        - atom: CD x: -26.01300048828125 y:4.7129998207092285 z:43.7400016784668
        - atom: OE1 x: -25.9689998626709 y:5.706999778747559 z:44.46099853515625
        - atom: NE2 x: -27.04400062561035 y:3.874000072479248 z:43.742000579833984
      - residue LEU has 8 atoms
        - atom: N x: -21.11199951171875 y:4.065000057220459 z:43.93299865722656
        - atom: CA x: -20.437000274658203 y:2.8420000076293945 z:44.3489990234375
        - atom: C x: -19.951000213623047 y:2.9660000801086426 z:45.7859992980957
        - atom: O x: -19.659000396728516 y:1.9639999866485596 z:46.42499923706055
        - atom: CB x: -19.267000198364258 y:2.5199999809265137 z:43.4109992980957
        - atom: CG x: -19.673999786376953 y:1.9570000171661377 z:42.04199981689453
        - atom: CD1 x: -18.472999572753906 y:1.777999997138977 z:41.165000915527344
        - atom: CD2 x: -20.384000778198242 y:0.628000020980835 z:42.23400115966797
      - residue GLN has 9 atoms
        - atom: N x: -19.868000030517578 y:4.198999881744385 z:46.28799819946289
        - atom: CA x: -19.44499969482422 y:4.461999893188477 z:47.66899871826172
        - atom: C x: -20.687999725341797 y:4.511000156402588 z:48.558998107910156
        - atom: O x: -20.60099983215332 y:4.388999938964844 z:49.7869987487793
        - atom: CB x: -18.71500015258789 y:5.809000015258789 z:47.7859992980957
        - atom: CG x: -17.40399932861328 y:5.919000148773193 z:47.03499984741211
        - atom: CD x: -16.65999984741211 y:7.2210001945495605 z:47.33300018310547
        - atom: OE1 x: -17.259000778198242 y:8.29800033569336 z:47.375999450683594
        - atom: NE2 x: -15.347000122070312 y:7.123000144958496 z:47.527000427246094
      - residue LYS has 9 atoms
        - atom: N x: -21.84000015258789 y:4.710000038146973 z:47.92300033569336
        - atom: CA x: -23.118000030517578 y:4.790999889373779 z:48.62099838256836
        - atom: C x: -23.485000610351562 y:3.427999973297119 z:49.20899963378906
        - atom: O x: -23.861000061035156 y:3.321000099182129 z:50.37699890136719
        - atom: CB x: -24.209999084472656 y:5.244999885559082 z:47.6510009765625
        - atom: CG x: -25.493000030517578 y:5.758999824523926 z:48.308998107910156
        - atom: CD x: -25.284000396728516 y:7.151000022888184 z:48.91600036621094
        - atom: CE x: -26.61400032043457 y:7.869999885559082 z:49.20199966430664
        - atom: NZ x: -27.492000579833984 y:7.140999794006348 z:50.17300033569336
      - residue VAL has 7 atoms
        - atom: N x: -23.381000518798828 y:2.38700008392334 z:48.391998291015625
        - atom: CA x: -23.690000534057617 y:1.0379999876022339 z:48.84199905395508
        - atom: C x: -22.56100082397461 y:0.5149999856948853 z:49.72800064086914
        - atom: O x: -22.729000091552734 y:-0.4690000116825104 z:50.45100021362305
        - atom: CB x: -23.85300064086914 y:0.07800000160932541 z:47.645999908447266
        - atom: CG1 x: -25.08300018310547 y:0.44999998807907104 z:46.845001220703125
        - atom: CG2 x: -22.618999481201172 y:0.13099999725818634 z:46.76300048828125
      - residue HIS has 10 atoms
        - atom: N x: -21.413999557495117 y:1.187999963760376 z:49.66400146484375
        - atom: CA x: -20.229000091552734 y:0.8109999895095825 z:50.428001403808594
        - atom: C x: -19.409000396728516 y:-0.27000001072883606 z:49.709999084472656
        - atom: O x: -18.84000015258789 y:-1.152999997138977 z:50.35200119018555
        - atom: CB x: -20.610000610351562 y:0.33399999141693115 z:51.8390007019043
        - atom: CG x: -21.040000915527344 y:1.437000036239624 z:52.7599983215332
        - atom: ND1 x: -22.143999099731445 y:1.3350000381469727 z:53.582000732421875
        - atom: CD2 x: -20.5 y:2.6549999713897705 z:53.0099983215332
        - atom: CE1 x: -22.266000747680664 y:2.440000057220459 z:54.297000885009766
        - atom: NE2 x: -21.281999588012695 y:3.257999897003174 z:53.96900177001953
      - residue PHE has 11 atoms
        - atom: N x: -19.360000610351562 y:-0.20000000298023224 z:48.37799835205078
        - atom: CA x: -18.570999145507812 y:-1.1480000019073486 z:47.59000015258789
        - atom: C x: -17.174999237060547 y:-0.5789999961853027 z:47.39500045776367
        - atom: O x: -16.20800018310547 y:-1.3270000219345093 z:47.3650016784668
        - atom: CB x: -19.187999725341797 y:-1.3940000534057617 z:46.220001220703125
        - atom: CG x: -18.344999313354492 y:-2.2720000743865967 z:45.32500076293945
        - atom: CD1 x: -18.054000854492188 y:-3.5820000171661377 z:45.685001373291016
        - atom: CD2 x: -17.84600067138672 y:-1.784999966621399 z:44.11899948120117
        - atom: CE1 x: -17.288999557495117 y:-4.38700008392334 z:44.86800003051758
        - atom: CE2 x: -17.076000213623047 y:-2.5869998931884766 z:43.29399871826172
        - atom: CZ x: -16.79800033569336 y:-3.8910000324249268 z:43.67100143432617
      - residue ILE has 8 atoms
        - atom: N x: -17.072999954223633 y:0.7419999837875366 z:47.24300003051758
        - atom: CA x: -15.77400016784668 y:1.3860000371932983 z:47.08300018310547
        - atom: C x: -15.430999755859375 y:1.9910000562667847 z:48.42300033569336
        - atom: O x: -16.05900001525879 y:2.953000068664551 z:48.85200119018555
        - atom: CB x: -15.774999618530273 y:2.503000020980835 z:45.97999954223633
        - atom: CG1 x: -15.883000373840332 y:1.871000051498413 z:44.58399963378906
        - atom: CG2 x: -14.479000091552734 y:3.2899999618530273 z:46.02199935913086
        - atom: CD1 x: -15.685999870300293 y:2.8510000705718994 z:43.44300079345703
      - residue THR has 7 atoms
        - atom: N x: -14.427000045776367 y:1.4140000343322754 z:49.073001861572266
        - atom: CA x: -13.984999656677246 y:1.8559999465942383 z:50.388999938964844
        - atom: C x: -12.88599967956543 y:2.9140000343322754 z:50.402000427246094
        - atom: O x: -12.743000030517578 y:3.63100004196167 z:51.39099884033203
        - atom: CB x: -13.479000091552734 y:0.6610000133514404 z:51.25299835205078
        - atom: OG1 x: -12.404000282287598 y:-0.0020000000949949026 z:50.58300018310547
        - atom: CG2 x: -14.581000328063965 y:-0.32600000500679016 z:51.51499938964844
      - residue ASP has 8 atoms
        - atom: N x: -12.095000267028809 y:3.01200008392334 z:49.3390007019043
        - atom: CA x: -11.015000343322754 y:4.000999927520752 z:49.31800079345703
        - atom: C x: -10.654000282287598 y:4.551000118255615 z:47.93299865722656
        - atom: O x: -10.78600025177002 y:3.868000030517578 z:46.915000915527344
        - atom: CB x: -9.744000434875488 y:3.4130001068115234 z:49.9630012512207
        - atom: CG x: -10.015000343322754 y:2.7699999809265137 z:51.31800079345703
        - atom: OD1 x: -10.675000190734863 y:1.7079999446868896 z:51.349998474121094
        - atom: OD2 x: -9.574000358581543 y:3.3239998817443848 z:52.35100173950195
      - residue THR has 7 atoms
        - atom: N x: -10.157999992370605 y:5.7870001792907715 z:47.93199920654297
        - atom: CA x: -9.746999740600586 y:6.508999824523926 z:46.73899841308594
        - atom: C x: -8.234999656677246 y:6.723999977111816 z:46.68000030517578
        - atom: O x: -7.664999961853027 y:7.307000160217285 z:47.59000015258789
        - atom: CB x: -10.407999992370605 y:7.89300012588501 z:46.715999603271484
        - atom: OG1 x: -11.79800033569336 y:7.748000144958496 z:46.40999984741211
        - atom: CG2 x: -9.73799991607666 y:8.803000450134277 z:45.6879997253418
      - residue LEU has 8 atoms
        - atom: N x: -7.583000183105469 y:6.265999794006348 z:45.612998962402344
        - atom: CA x: -6.146999835968018 y:6.489999771118164 z:45.47800064086914
        - atom: C x: -5.991000175476074 y:7.702000141143799 z:44.57099914550781
        - atom: O x: -5.010000228881836 y:8.442000389099121 z:44.667999267578125
        - atom: CB x: -5.427999973297119 y:5.298999786376953 z:44.83100128173828
        - atom: CG x: -5.5980000495910645 y:3.871999979019165 z:45.35599899291992
        - atom: CD1 x: -4.579999923706055 y:2.9730000495910645 z:44.696998596191406
        - atom: CD2 x: -5.414999961853027 y:3.8259999752044678 z:46.847999572753906
      - residue SER has 6 atoms
        - atom: N x: -6.9710001945495605 y:7.901000022888184 z:43.694000244140625
        - atom: CA x: -6.947999954223633 y:9.012999534606934 z:42.74399948120117
        - atom: C x: -8.258999824523926 y:9.112000465393066 z:41.98500061035156
        - atom: O x: -8.848999977111816 y:8.095000267028809 z:41.61399841308594
        - atom: CB x: -5.817999839782715 y:8.831999778747559 z:41.74100112915039
        - atom: OG x: -6.002999782562256 y:7.638999938964844 z:41.01300048828125
      - residue LYS has 9 atoms
        - atom: N x: -8.70300006866455 y:10.340999603271484 z:41.74800109863281
        - atom: CA x: -9.954000473022461 y:10.569999694824219 z:41.04100036621094
        - atom: C x: -9.918000221252441 y:11.857999801635742 z:40.21900177001953
        - atom: O x: -9.762999534606934 y:12.961999893188477 z:40.74599838256836
        - atom: CB x: -11.107999801635742 y:10.605999946594238 z:42.04499816894531
        - atom: CG x: -12.496000289916992 y:10.840999603271484 z:41.47100067138672
        - atom: CD x: -13.52299976348877 y:10.961000442504883 z:42.61000061035156
        - atom: CE x: -14.862000465393066 y:11.560999870300293 z:42.15599822998047
        - atom: NZ x: -14.739999771118164 y:12.946999549865723 z:41.57699966430664
      - residue GLY has 4 atoms
        - atom: N x: -10.03600025177002 y:11.694000244140625 z:38.90800094604492
        - atom: CA x: -10.041999816894531 y:12.824000358581543 z:38.00600051879883
        - atom: C x: -11.36400032043457 y:12.800000190734863 z:37.26900100708008
        - atom: O x: -12.270999908447266 y:12.064000129699707 z:37.66899871826172
      - residue GLU has 9 atoms
        - atom: N x: -11.475000381469727 y:13.581999778747559 z:36.19599914550781
        - atom: CA x: -12.708999633789062 y:13.637999534606934 z:35.41299819946289
        - atom: C x: -12.991000175476074 y:12.404999732971191 z:34.569000244140625
        - atom: O x: -14.145000457763672 y:12.163000106811523 z:34.23899841308594
        - atom: CB x: -12.729000091552734 y:14.871000289916992 z:34.49399948120117
        - atom: CG x: -12.994000434875488 y:16.202999114990234 z:35.20000076293945
        - atom: CD x: -14.388999938964844 y:16.284000396728516 z:35.803001403808594
        - atom: OE1 x: -14.821999549865723 y:15.300000190734863 z:36.452999114990234
        - atom: OE2 x: -15.04800033569336 y:17.33300018310547 z:35.64099884033203
      - residue THR has 7 atoms
        - atom: N x: -11.963000297546387 y:11.63700008392334 z:34.209999084472656
        - atom: CA x: -12.175000190734863 y:10.432999610900879 z:33.39699935913086
        - atom: C x: -11.51200008392334 y:9.157999992370605 z:33.95399856567383
        - atom: O x: -11.673999786376953 y:8.072999954223633 z:33.38600158691406
        - atom: CB x: -11.6850004196167 y:10.630000114440918 z:31.908000946044922
        - atom: OG1 x: -10.255999565124512 y:10.644000053405762 z:31.856000900268555
        - atom: CG2 x: -12.185999870300293 y:11.944999694824219 z:31.336999893188477
      - residue LYS has 9 atoms
        - atom: N x: -10.781000137329102 y:9.277000427246094 z:35.06399917602539
        - atom: CA x: -10.095999717712402 y:8.119999885559082 z:35.63800048828125
        - atom: C x: -10.126999855041504 y:8.034000396728516 z:37.154998779296875
        - atom: O x: -9.835000038146973 y:9.008000373840332 z:37.849998474121094
        - atom: CB x: -8.642999649047852 y:8.10099983215332 z:35.18199920654297
        - atom: CG x: -7.811999797821045 y:7.0980000495910645 z:35.92300033569336
        - atom: CD x: -6.353000164031982 y:7.2220001220703125 z:35.58100128173828
        - atom: CE x: -5.540999889373779 y:6.206999778747559 z:36.380001068115234
        - atom: NZ x: -4.105000019073486 y:6.232999801635742 z:36.0
      - residue PHE has 11 atoms
        - atom: N x: -10.454000473022461 y:6.8460001945495605 z:37.65800094604492
        - atom: CA x: -10.522000312805176 y:6.5879998207092285 z:39.090999603271484
        - atom: C x: -9.812000274658203 y:5.298999786376953 z:39.49700164794922
        - atom: O x: -10.163999557495117 y:4.2129998207092285 z:39.051998138427734
        - atom: CB x: -11.984000205993652 y:6.501999855041504 z:39.547000885009766
        - atom: CG x: -12.156000137329102 y:6.059999942779541 z:40.986000061035156
        - atom: CD1 x: -11.930999755859375 y:6.936999797821045 z:42.0359992980957
        - atom: CD2 x: -12.531000137329102 y:4.756999969482422 z:41.2859992980957
        - atom: CE1 x: -12.079000473022461 y:6.519000053405762 z:43.36600112915039
        - atom: CE2 x: -12.678999900817871 y:4.329999923706055 z:42.61800003051758
        - atom: CZ x: -12.45300006866455 y:5.210999965667725 z:43.652000427246094
      - residue MET has 8 atoms
        - atom: N x: -8.805999755859375 y:5.428999900817871 z:40.35100173950195
        - atom: CA x: -8.081999778747559 y:4.275000095367432 z:40.875
        - atom: C x: -8.491999626159668 y:4.190000057220459 z:42.34199905395508
        - atom: O x: -8.345999717712402 y:5.159999847412109 z:43.09000015258789
        - atom: CB x: -6.578999996185303 y:4.486000061035156 z:40.77000045776367
        - atom: CG x: -6.034999847412109 y:4.218999862670898 z:39.39500045776367
        - atom: SD x: -4.295000076293945 y:4.629000186920166 z:39.29399871826172
        - atom: CE x: -3.693000078201294 y:3.8350000381469727 z:40.74300003051758
      - residue GLY has 4 atoms
        - atom: N x: -9.01200008392334 y:3.0390000343322754 z:42.7599983215332
        - atom: CA x: -9.442999839782715 y:2.933000087738037 z:44.13600158691406
        - atom: C x: -9.482999801635742 y:1.5640000104904175 z:44.742000579833984
        - atom: O x: -8.850000381469727 y:0.6309999823570251 z:44.27000045776367
      - residue VAL has 7 atoms
        - atom: N x: -10.26200008392334 y:1.4559999704360962 z:45.80400085449219
        - atom: CA x: -10.385000228881836 y:0.21899999678134918 z:46.54199981689453
        - atom: C x: -11.847000122070312 y:-0.14499999582767487 z:46.7239990234375
        - atom: O x: -12.666000366210938 y:0.7099999785423279 z:47.07899856567383
        - atom: CB x: -9.720000267028809 y:0.36800000071525574 z:47.94599914550781
        - atom: CG1 x: -9.960000038146973 y:-0.8809999823570251 z:48.790000915527344
        - atom: CG2 x: -8.218000411987305 y:0.6430000066757202 z:47.7869987487793
      - residue CYS has 6 atoms
        - atom: N x: -12.168999671936035 y:-1.4140000343322754 z:46.46799850463867
        - atom: CA x: -13.529000282287598 y:-1.909000039100647 z:46.63399887084961
        - atom: C x: -13.513999938964844 y:-3.187000036239624 z:47.46699905395508
        - atom: O x: -12.456000328063965 y:-3.759000062942505 z:47.72200012207031
        - atom: CB x: -14.20300006866455 y:-2.1549999713897705 z:45.277000427246094
        - atom: SG x: -13.541000366210938 y:-3.48799991607666 z:44.275001525878906
      - residue GLN has 9 atoms
        - atom: N x: -14.690999984741211 y:-3.625999927520752 z:47.900001525878906
        - atom: CA x: -14.809000015258789 y:-4.818999767303467 z:48.72600173950195
        - atom: C x: -16.209999084472656 y:-5.434999942779541 z:48.64799880981445
        - atom: O x: -17.215999603271484 y:-4.756999969482422 z:48.869998931884766
        - atom: CB x: -14.467000007629395 y:-4.459000110626221 z:50.178001403808594
        - atom: CG x: -14.763999938964844 y:-5.531000137329102 z:51.202999114990234
        - atom: CD x: -14.333999633789062 y:-5.130000114440918 z:52.604000091552734
        - atom: OE1 x: -14.741000175476074 y:-4.0879998207092285 z:53.11800003051758
        - atom: NE2 x: -13.508000373840332 y:-5.961999893188477 z:53.231998443603516
      - residue LEU has 8 atoms
        - atom: N x: -16.267000198364258 y:-6.71999979019165 z:48.31399917602539
        - atom: CA x: -17.533000946044922 y:-7.429999828338623 z:48.22800064086914
        - atom: C x: -18.14900016784668 y:-7.479000091552734 z:49.61899948120117
        - atom: O x: -17.454999923706055 y:-7.729000091552734 z:50.595001220703125
        - atom: CB x: -17.297000885009766 y:-8.852999687194824 z:47.722999572753906
        - atom: CG x: -16.979000091552734 y:-9.00100040435791 z:46.236000061035156
        - atom: CD1 x: -16.43600082397461 y:-10.39799976348877 z:45.946998596191406
        - atom: CD2 x: -18.249000549316406 y:-8.720000267028809 z:45.43000030517578
      - residue PRO has 7 atoms
        - atom: N x: -19.459999084472656 y:-7.241000175476074 z:49.733001708984375
        - atom: CA x: -20.0939998626709 y:-7.28000020980835 z:51.053001403808594
        - atom: C x: -20.091999053955078 y:-8.692999839782715 z:51.62099838256836
        - atom: O x: -20.04400062561035 y:-9.668000221252441 z:50.87300109863281
        - atom: CB x: -21.49799919128418 y:-6.7829999923706055 z:50.763999938964844
        - atom: CG x: -21.75200080871582 y:-7.359000205993652 z:49.42300033569336
        - atom: CD x: -20.466999053955078 y:-7.035999774932861 z:48.683998107910156
      - residue SER has 6 atoms
        - atom: N x: -20.14299964904785 y:-8.800000190734863 z:52.944000244140625
        - atom: CA x: -20.150999069213867 y:-10.104999542236328 z:53.59000015258789
        - atom: C x: -21.516000747680664 y:-10.470999717712402 z:54.14400100708008
        - atom: O x: -22.22800064086914 y:-9.626999855041504 z:54.69300079345703
        - atom: CB x: -19.11400032043457 y:-10.157999992370605 z:54.71099853515625
        - atom: OG x: -17.80299949645996 y:-10.243000030517578 z:54.176998138427734
      - residue LYS has 9 atoms
        - atom: N x: -21.854999542236328 y:-11.748000144958496 z:53.99100112915039
        - atom: CA x: -23.124000549316406 y:-12.317000389099121 z:54.44300079345703
        - atom: C x: -23.631999969482422 y:-11.708000183105469 z:55.74700164794922
        - atom: O x: -24.525999069213867 y:-10.859999656677246 z:55.74100112915039
        - atom: CB x: -22.985000610351562 y:-13.836000442504883 z:54.61800003051758
        - atom: CG x: -22.371000289916992 y:-14.569000244140625 z:53.42399978637695
        - atom: CD x: -20.875999450683594 y:-14.298999786376953 z:53.28200149536133
        - atom: CE x: -20.301000595092773 y:-14.970999717712402 z:52.04600143432617
        - atom: NZ x: -18.827999114990234 y:-14.781999588012695 z:51.97600173950195
      - residue ASN has 8 atoms
        - atom: N x: -23.066999435424805 y:-12.161999702453613 z:56.861000061035156
        - atom: CA x: -23.440000534057617 y:-11.675999641418457 z:58.18600082397461
        - atom: C x: -22.19700050354004 y:-11.550000190734863 z:59.04600143432617
        - atom: O x: -21.503999710083008 y:-10.529999732971191 z:59.018001556396484
        - atom: CB x: -24.42300033569336 y:-12.637999534606934 z:58.86199951171875
        - atom: CG x: -25.77899932861328 y:-12.663999557495117 z:58.180999755859375
        - atom: OD1 x: -25.885000228881836 y:-12.98799991607666 z:56.99300003051758
        - atom: ND2 x: -26.826000213623047 y:-12.321999549865723 z:58.93000030517578
      - residue ASP has 8 atoms
        - atom: N x: -21.91200065612793 y:-12.593999862670898 z:59.8120002746582
        - atom: CA x: -20.743000030517578 y:-12.5649995803833 z:60.667999267578125
        - atom: C x: -19.663999557495117 y:-13.559000015258789 z:60.22200012207031
        - atom: O x: -19.101999282836914 y:-14.295999526977539 z:61.034000396728516
        - atom: CB x: -21.1560001373291 y:-12.817000389099121 z:62.12099838256836
        - atom: CG x: -20.41699981689453 y:-11.913000106811523 z:63.0989990234375
        - atom: OD1 x: -20.413000106811523 y:-10.680999755859375 z:62.880001068115234
        - atom: OD2 x: -19.844999313354492 y:-12.430999755859375 z:64.08399963378906
      - residue GLU has 9 atoms
        - atom: N x: -19.38800048828125 y:-13.57699966430664 z:58.917999267578125
        - atom: CA x: -18.354000091552734 y:-14.447999954223633 z:58.375
        - atom: C x: -17.06800079345703 y:-13.638999938964844 z:58.441001892089844
        - atom: O x: -16.729000091552734 y:-13.08899974822998 z:59.4900016784668
        - atom: CB x: -18.63800048828125 y:-14.824999809265137 z:56.91699981689453
        - atom: CG x: -19.93899917602539 y:-15.576000213623047 z:56.67300033569336
        - atom: CD x: -21.152000427246094 y:-14.701000213623047 z:56.88600158691406
        - atom: OE1 x: -21.05900001525879 y:-13.493000030517578 z:56.584999084472656
        - atom: OE2 x: -22.195999145507812 y:-15.218000411987305 z:57.3380012512207
      - residue LYS has 9 atoms
        - atom: N x: -16.361000061035156 y:-13.54699993133545 z:57.319000244140625
        - atom: CA x: -15.116000175476074 y:-12.793999671936035 z:57.284000396728516
        - atom: C x: -15.039999961853027 y:-11.869000434875488 z:56.07699966430664
        - atom: O x: -15.192000389099121 y:-12.310999870300293 z:54.941001892089844
        - atom: CB x: -13.92300033569336 y:-13.751999855041504 z:57.27399826049805
        - atom: CG x: -12.5600004196167 y:-13.060999870300293 z:57.27399826049805
        - atom: CD x: -11.418999671936035 y:-14.069999694824219 z:57.36899948120117
        - atom: CE x: -11.454000473022461 y:-15.064000129699707 z:56.21500015258789
        - atom: NZ x: -10.368000030517578 y:-16.07900047302246 z:56.319000244140625
      - residue GLU has 9 atoms
        - atom: N x: -14.805000305175781 y:-10.585000038146973 z:56.340999603271484
        - atom: CA x: -14.687000274658203 y:-9.57800006866455 z:55.292999267578125
        - atom: C x: -13.902999877929688 y:-10.180000305175781 z:54.125999450683594
        - atom: O x: -12.942000389099121 y:-10.918999671936035 z:54.34199905395508
        - atom: CB x: -13.907999992370605 y:-8.350000381469727 z:55.79999923706055
        - atom: CG x: -14.197999954223633 y:-7.88700008392334 z:57.22200012207031
        - atom: CD x: -13.293000221252441 y:-6.72599983215332 z:57.652000427246094
        - atom: OE1 x: -13.357000350952148 y:-5.650000095367432 z:57.01900100708008
        - atom: OE2 x: -12.512999534606934 y:-6.883999824523926 z:58.62099838256836
      - residue TYR has 12 atoms
        - atom: N x: -14.315999984741211 y:-9.883000373840332 z:52.895999908447266
        - atom: CA x: -13.588000297546387 y:-10.373000144958496 z:51.72700119018555
        - atom: C x: -12.331000328063965 y:-9.508000373840332 z:51.678001403808594
        - atom: O x: -12.291000366210938 y:-8.444000244140625 z:52.292999267578125
        - atom: CB x: -14.402000427246094 y:-10.159000396728516 z:50.44300079345703
        - atom: CG x: -15.472000122070312 y:-11.201000213623047 z:50.17599868774414
        - atom: CD1 x: -15.234999656677246 y:-12.276000022888184 z:49.31800079345703
        - atom: CD2 x: -16.729000091552734 y:-11.105999946594238 z:50.7760009765625
        - atom: CE1 x: -16.225000381469727 y:-13.22700023651123 z:49.064998626708984
        - atom: CE2 x: -17.722999572753906 y:-12.048999786376953 z:50.52899932861328
        - atom: CZ x: -17.465999603271484 y:-13.100000381469727 z:49.67599868774414
        - atom: OH x: -18.458999633789062 y:-14.013999938964844 z:49.433998107910156
      - residue PRO has 7 atoms
        - atom: N x: -11.282999992370605 y:-9.958999633789062 z:50.972999572753906
        - atom: CA x: -10.079999923706055 y:-9.125 z:50.917999267578125
        - atom: C x: -10.451000213623047 y:-7.831999778747559 z:50.20899963378906
        - atom: O x: -11.345000267028809 y:-7.835000038146973 z:49.35900115966797
        - atom: CB x: -9.114999771118164 y:-9.960000038146973 z:50.07699966430664
        - atom: CG x: -9.54699993133545 y:-11.354000091552734 z:50.3380012512207
        - atom: CD x: -11.050999641418457 y:-11.258999824523926 z:50.32500076293945
      - residue HIS has 10 atoms
        - atom: N x: -9.805000305175781 y:-6.724999904632568 z:50.560001373291016
        - atom: CA x: -10.095000267028809 y:-5.4710001945495605 z:49.867000579833984
        - atom: C x: -9.428000450134277 y:-5.605000019073486 z:48.49399948120117
        - atom: O x: -8.277999877929688 y:-6.047999858856201 z:48.395999908447266
        - atom: CB x: -9.512999534606934 y:-4.267000198364258 z:50.619998931884766
        - atom: CG x: -10.348999977111816 y:-3.796999931335449 z:51.77000045776367
        - atom: ND1 x: -10.534000396728516 y:-4.544000148773193 z:52.91400146484375
        - atom: CD2 x: -11.008000373840332 y:-2.631999969482422 z:51.97100067138672
        - atom: CE1 x: -11.263999938964844 y:-3.8559999465942383 z:53.77299880981445
        - atom: NE2 x: -11.564000129699707 y:-2.691999912261963 z:53.224998474121094
      - residue ARG has 11 atoms
        - atom: N x: -10.140999794006348 y:-5.234000205993652 z:47.4370002746582
        - atom: CA x: -9.592000007629395 y:-5.364999771118164 z:46.08599853515625
        - atom: C x: -9.380000114440918 y:-4.051000118255615 z:45.33399963378906
        - atom: O x: -10.031000137329102 y:-3.0390000343322754 z:45.611000061035156
        - atom: CB x: -10.51200008392334 y:-6.256999969482422 z:45.25899887084961
        - atom: CG x: -10.968999862670898 y:-7.511000156402588 z:45.96200180053711
        - atom: CD x: -9.836999893188477 y:-8.48799991607666 z:46.11199951171875
        - atom: NE x: -10.319000244140625 y:-9.800999641418457 z:46.51900100708008
        - atom: CZ x: -9.5600004196167 y:-10.888999938964844 z:46.54499816894531
        - atom: NH1 x: -8.28499984741211 y:-10.8100004196167 z:46.19200134277344
        - atom: NH2 x: -10.07699966430664 y:-12.057000160217285 z:46.902000427246094
      - residue ARG has 11 atoms
        - atom: N x: -8.461999893188477 y:-4.076000213623047 z:44.375
        - atom: CA x: -8.197999954223633 y:-2.8940000534057617 z:43.558998107910156
        - atom: C x: -9.196999549865723 y:-2.7960000038146973 z:42.402000427246094
        - atom: O x: -9.545999526977539 y:-3.7890000343322754 z:41.75600051879883
        - atom: CB x: -6.775000095367432 y:-2.9260001182556152 z:42.994998931884766
        - atom: CG x: -5.702000141143799 y:-2.631999969482422 z:44.012001037597656
        - atom: CD x: -5.521999835968018 y:-1.1480000019073486 z:44.24100112915039
        - atom: NE x: -4.9710001945495605 y:-0.4950000047683716 z:43.0629997253418
        - atom: CZ x: -5.703999996185303 y:0.11400000005960464 z:42.13800048828125
        - atom: NH1 x: -7.0279998779296875 y:0.16500000655651093 z:42.25899887084961
        - atom: NH2 x: -5.113999843597412 y:0.652999997138977 z:41.07899856567383
      - residue ILE has 8 atoms
        - atom: N x: -9.649999618530273 y:-1.5729999542236328 z:42.15399932861328
        - atom: CA x: -10.597000122070312 y:-1.2949999570846558 z:41.0880012512207
        - atom: C x: -10.175000190734863 y:-0.020999999716877937 z:40.34199905395508
        - atom: O x: -9.767999649047852 y:0.9660000205039978 z:40.95800018310547
        - atom: CB x: -12.017999649047852 y:-1.1380000114440918 z:41.68000030517578
        - atom: CG1 x: -13.008999824523926 y:-0.7609999775886536 z:40.59199905395508
        - atom: CG2 x: -12.031000137329102 y:-0.08799999952316284 z:42.75
        - atom: CD1 x: -14.376999855041504 y:-0.5450000166893005 z:41.137001037597656
      - residue ASP has 8 atoms
        - atom: N x: -10.21500015258789 y:-0.07400000095367432 z:39.01499938964844
        - atom: CA x: -9.883000373840332 y:1.069000005722046 z:38.1619987487793
        - atom: C x: -11.109000205993652 y:1.2790000438690186 z:37.2760009765625
        - atom: O x: -11.706999778747559 y:0.3100000023841858 z:36.80699920654297
        - atom: CB x: -8.668000221252441 y:0.7850000262260437 z:37.270999908447266
        - atom: CG x: -7.4070000648498535 y:0.503000020980835 z:38.064998626708984
        - atom: OD1 x: -7.235000133514404 y:1.093000054359436 z:39.1510009765625
        - atom: OD2 x: -6.578999996185303 y:-0.30000001192092896 z:37.5890007019043
      - residue ILE has 8 atoms
        - atom: N x: -11.487000465393066 y:2.5350000858306885 z:37.05500030517578
        - atom: CA x: -12.64799976348877 y:2.8480000495910645 z:36.23400115966797
        - atom: C x: -12.291999816894531 y:4.013000011444092 z:35.319000244140625
        - atom: O x: -11.878999710083008 y:5.072000026702881 z:35.79499816894531
        - atom: CB x: -13.845999717712402 y:3.256999969482422 z:37.12300109863281
        - atom: CG1 x: -14.107999801635742 y:2.1679999828338623 z:38.16699981689453
        - atom: CG2 x: -15.086999893188477 y:3.505000114440918 z:36.266998291015625
        - atom: CD1 x: -15.119000434875488 y:2.562000036239624 z:39.233001708984375
      - residue ARG has 11 atoms
        - atom: N x: -12.4399995803833 y:3.8239998817443848 z:34.01100158691406
        - atom: CA x: -12.133000373840332 y:4.89300012588501 z:33.064998626708984
        - atom: C x: -13.319999694824219 y:5.24399995803833 z:32.17399978637695
        - atom: O x: -13.930999755859375 y:4.36899995803833 z:31.548999786376953
        - atom: CB x: -10.928000450134277 y:4.513000011444092 z:32.202999114990234
        - atom: CG x: -9.746000289916992 y:4.109000205993652 z:33.055999755859375
        - atom: CD x: -8.42300033569336 y:4.166999816894531 z:32.321998596191406
        - atom: NE x: -7.381999969482422 y:3.446000099182129 z:33.055999755859375
        - atom: CZ x: -6.118000030517578 y:3.3529999256134033 z:32.65599822998047
        - atom: NH1 x: -5.738999843597412 y:3.947000026702881 z:31.527999877929688
        - atom: NH2 x: -5.239999771118164 y:2.6530001163482666 z:33.36800003051758
      - residue LEU has 8 atoms
        - atom: N x: -13.649999618530273 y:6.5329999923706055 z:32.150001525878906
        - atom: CA x: -14.743000030517578 y:7.039999961853027 z:31.347000122070312
        - atom: C x: -14.180999755859375 y:7.448999881744385 z:29.990999221801758
        - atom: O x: -13.451000213623047 y:8.435999870300293 z:29.905000686645508
        - atom: CB x: -15.355999946594238 y:8.258999824523926 z:32.018001556396484
        - atom: CG x: -16.48200035095215 y:8.942999839782715 z:31.2450008392334
        - atom: CD1 x: -17.711000442504883 y:8.062999725341797 z:31.25
        - atom: CD2 x: -16.80299949645996 y:10.270000457763672 z:31.878000259399414
      - residue ILE has 8 atoms
        - atom: N x: -14.506999969482422 y:6.693999767303467 z:28.940000534057617
        - atom: CA x: -14.029000282287598 y:7.00600004196167 z:27.59600067138672
        - atom: C x: -15.149999618530273 y:7.5229997634887695 z:26.711000442504883
        - atom: O x: -16.299999237060547 y:7.142000198364258 z:26.871999740600586
        - atom: CB x: -13.437999725341797 y:5.7779998779296875 z:26.885000228881836
        - atom: CG1 x: -14.513999938964844 y:4.703999996185303 z:26.7549991607666
        - atom: CG2 x: -12.199999809265137 y:5.271999835968018 z:27.624000549316406
        - atom: CD1 x: -14.071999549865723 y:3.513000011444092 z:25.937999725341797
      - residue PRO has 7 atoms
        - atom: N x: -14.821000099182129 y:8.404000282287598 z:25.766000747680664
        - atom: CA x: -15.810999870300293 y:8.979000091552734 z:24.83799934387207
        - atom: C x: -16.490999221801758 y:7.840000152587891 z:24.062999725341797
        - atom: O x: -15.810999870300293 y:6.901000022888184 z:23.624000549316406
        - atom: CB x: -14.961999893188477 y:9.873000144958496 z:23.937999725341797
        - atom: CG x: -13.824999809265137 y:10.289999961853027 z:24.843000411987305
        - atom: CD x: -13.48900032043457 y:8.99899959564209 z:25.56800079345703
      - residue LYS has 9 atoms
        - atom: N x: -17.80900001525879 y:7.921999931335449 z:23.8799991607666
        - atom: CA x: -18.554000854492188 y:6.8480000495910645 z:23.209999084472656
        - atom: C x: -18.02199935913086 y:6.297999858856201 z:21.886999130249023
        - atom: O x: -17.986000061035156 y:5.081999778747559 z:21.684999465942383
        - atom: CB x: -20.007999420166016 y:7.251999855041504 z:22.993000030517578
        - atom: CG x: -20.899999618530273 y:6.093999862670898 z:22.548999786376953
        - atom: CD x: -21.552000045776367 y:5.38100004196167 z:23.746000289916992
        - atom: CE x: -22.51300048828125 y:4.2829999923706055 z:23.280000686645508
        - atom: NZ x: -23.47800064086914 y:3.8610000610351562 z:24.336000442504883
      - residue ASP has 8 atoms
        - atom: N x: -17.625999450683594 y:7.181000232696533 z:20.983999252319336
        - atom: CA x: -17.1200008392334 y:6.754000186920166 z:19.68600082397461
        - atom: C x: -15.680000305175781 y:6.251999855041504 z:19.711999893188477
        - atom: O x: -15.003000259399414 y:6.2179999351501465 z:18.670000076293945
        - atom: CB x: -17.22599983215332 y:7.90500020980835 z:18.687000274658203
        - atom: CG x: -16.69099998474121 y:9.199000358581543 z:19.2450008392334
        - atom: OD1 x: -15.991000175476074 y:9.913999557495117 z:18.503999710083008
        - atom: OD2 x: -16.976999282836914 y:9.498000144958496 z:20.422000885009766
      - residue GLN has 9 atoms
        - atom: N x: -15.208000183105469 y:5.869999885559082 z:20.895000457763672
        - atom: CA x: -13.840999603271484 y:5.36899995803833 z:21.02899932861328
        - atom: C x: -13.864999771118164 y:4.067999839782715 z:21.81100082397461
        - atom: O x: -12.859999656677246 y:3.375 z:21.93899917602539
        - atom: CB x: -12.97700023651123 y:6.406000137329102 z:21.72800064086914
        - atom: CG x: -13.196000099182129 y:7.809000015258789 z:21.20599937438965
        - atom: CD x: -11.937000274658203 y:8.630999565124512 z:21.261999130249023
        - atom: OE1 x: -11.22599983215332 y:8.621999740600586 z:22.266000747680664
        - atom: NE2 x: -11.645999908447266 y:9.350000381469727 z:20.18199920654297
      - residue TYR has 12 atoms
        - atom: N x: -15.048999786376953 y:3.755000114440918 z:22.316999435424805
        - atom: CA x: -15.3100004196167 y:2.546999931335449 z:23.077999114990234
        - atom: C x: -14.543000221252441 y:1.3359999656677246 z:22.562999725341797
        - atom: O x: -13.607999801635742 y:0.8619999885559082 z:23.190000534057617
        - atom: CB x: -16.804000854492188 y:2.242000102996826 z:23.031999588012695
        - atom: CG x: -17.19499969482422 y:1.00600004196167 z:23.79199981689453
        - atom: CD1 x: -17.104999542236328 y:0.9660000205039978 z:25.180999755859375
        - atom: CD2 x: -17.6299991607666 y:-0.13699999451637268 z:23.121000289916992
        - atom: CE1 x: -17.437999725341797 y:-0.1850000023841858 z:25.889999389648438
        - atom: CE2 x: -17.964000701904297 y:-1.2970000505447388 z:23.815000534057617
        - atom: CZ x: -17.865999221801758 y:-1.319000005722046 z:25.20199966430664
        - atom: OH x: -18.17799949645996 y:-2.4670000076293945 z:25.902000427246094
      - residue TYR has 12 atoms
        - atom: N x: -14.942999839782715 y:0.8270000219345093 z:21.410999298095703
        - atom: CA x: -14.288000106811523 y:-0.3409999907016754 z:20.8700008392334
        - atom: C x: -12.777999877929688 y:-0.21400000154972076 z:20.922000885009766
        - atom: O x: -12.097000122070312 y:-1.1469999551773071 z:21.32200050354004
        - atom: CB x: -14.779999732971191 y:-0.5960000157356262 z:19.445999145507812
        - atom: CG x: -16.284000396728516 y:-0.7670000195503235 z:19.385000228881836
        - atom: CD1 x: -16.902000427246094 y:-1.9190000295639038 z:19.878999710083008
        - atom: CD2 x: -17.097999572753906 y:0.25699999928474426 z:18.899999618530273
        - atom: CE1 x: -18.301000595092773 y:-2.0450000762939453 z:19.89900016784668
        - atom: CE2 x: -18.493999481201172 y:0.1469999998807907 z:18.916000366210938
        - atom: CZ x: -19.089000701904297 y:-1.0019999742507935 z:19.420000076293945
        - atom: OH x: -20.4689998626709 y:-1.069000005722046 z:19.485000610351562
      - residue CYS has 6 atoms
        - atom: N x: -12.243000030517578 y:0.9359999895095825 z:20.545000076293945
        - atom: CA x: -10.789999961853027 y:1.1050000190734863 z:20.573999404907227
        - atom: C x: -10.241999626159668 y:1.0920000076293945 z:22.003999710083008
        - atom: O x: -9.145000457763672 y:0.6069999933242798 z:22.257999420166016
        - atom: CB x: -10.390999794006348 y:2.4019999504089355 z:19.875999450683594
        - atom: SG x: -9.300999641418457 y:2.1089999675750732 z:18.48900032043457
      - residue GLY has 4 atoms
        - atom: N x: -11.019000053405762 y:1.6349999904632568 z:22.93199920654297
        - atom: CA x: -10.604000091552734 y:1.6460000276565552 z:24.31800079345703
        - atom: C x: -10.835000038146973 y:0.289000004529953 z:24.96299934387207
        - atom: O x: -10.050999641418457 y:-0.16200000047683716 z:25.792999267578125
      - residue VAL has 7 atoms
        - atom: N x: -11.920000076293945 y:-0.36800000071525574 z:24.582000732421875
        - atom: CA x: -12.220999717712402 y:-1.6660000085830688 z:25.134000778198242
        - atom: C x: -11.131999969482422 y:-2.628000020980835 z:24.66900062561035
        - atom: O x: -10.866999626159668 y:-3.63700008392334 z:25.305999755859375
        - atom: CB x: -13.607000350952148 y:-2.1589999198913574 z:24.66699981689453
        - atom: CG1 x: -13.576000213623047 y:-2.502000093460083 z:23.184999465942383
        - atom: CG2 x: -14.036999702453613 y:-3.3519999980926514 z:25.479999542236328
      - residue LEU has 8 atoms
        - atom: N x: -10.487000465393066 y:-2.309999942779541 z:23.559999465942383
        - atom: CA x: -9.4399995803833 y:-3.1710000038146973 z:23.065000534057617
        - atom: C x: -8.232999801635742 y:-2.9670000076293945 z:23.94700050354004
        - atom: O x: -7.6620001792907715 y:-3.9210000038146973 z:24.485000610351562
        - atom: CB x: -9.074000358581543 y:-2.805999994277954 z:21.634000778198242
        - atom: CG x: -7.961999893188477 y:-3.6480000019073486 z:21.007999420166016
        - atom: CD1 x: -8.39900016784668 y:-5.107999801635742 z:20.95599937438965
        - atom: CD2 x: -7.644999980926514 y:-3.119999885559082 z:19.613000869750977
      - residue TYR has 12 atoms
        - atom: N x: -7.855000019073486 y:-1.7059999704360962 z:24.0939998626709
        - atom: CA x: -6.703000068664551 y:-1.3450000286102295 z:24.893999099731445
        - atom: C x: -6.7870001792907715 y:-1.8880000114440918 z:26.312999725341797
        - atom: O x: -5.877999782562256 y:-2.578000068664551 z:26.77199935913086
        - atom: CB x: -6.550000190734863 y:0.17399999499320984 z:24.950000762939453
        - atom: CG x: -5.408999919891357 y:0.6000000238418579 z:25.836000442504883
        - atom: CD1 x: -4.098999977111816 y:0.5410000085830688 z:25.382999420166016
        - atom: CD2 x: -5.636000156402588 y:0.9879999756813049 z:27.158000946044922
        - atom: CE1 x: -3.0409998893737793 y:0.8510000109672546 z:26.216999053955078
        - atom: CE2 x: -4.584000110626221 y:1.2960000038146973 z:28.003999710083008
        - atom: CZ x: -3.2880001068115234 y:1.222000002861023 z:27.525999069213867
        - atom: OH x: -2.2260000705718994 y:1.49399995803833 z:28.360000610351562
      - residue PHE has 11 atoms
        - atom: N x: -7.882999897003174 y:-1.565000057220459 z:26.993999481201172
        - atom: CA x: -8.121000289916992 y:-1.968999981880188 z:28.378000259399414
        - atom: C x: -8.307999610900879 y:-3.4790000915527344 z:28.600000381469727
        - atom: O x: -8.409000396728516 y:-3.937999963760376 z:29.736000061035156
        - atom: CB x: -9.335000038146973 y:-1.2009999752044678 z:28.913999557495117
        - atom: CG x: -9.093999862670898 y:-0.5210000276565552 z:30.23200035095215
        - atom: CD1 x: -7.830999851226807 y:-0.009999999776482582 z:30.555999755859375
        - atom: CD2 x: -10.133000373840332 y:-0.37299999594688416 z:31.152999877929688
        - atom: CE1 x: -7.607999801635742 y:0.6340000033378601 z:31.783000946044922
        - atom: CE2 x: -9.920999526977539 y:0.27399998903274536 z:32.38800048828125
        - atom: CZ x: -8.659000396728516 y:0.7749999761581421 z:32.70100021362305
      - residue THR has 7 atoms
        - atom: N x: -8.368000030517578 y:-4.252999782562256 z:27.52199935913086
        - atom: CA x: -8.527000427246094 y:-5.695000171661377 z:27.659000396728516
        - atom: C x: -7.127999782562256 y:-6.291999816894531 z:27.558000564575195
        - atom: O x: -6.834000110626221 y:-7.348999977111816 z:28.125
        - atom: CB x: -9.447999954223633 y:-6.2870001792907715 z:26.538000106811523
        - atom: OG1 x: -10.755999565124512 y:-5.709000110626221 z:26.632999420166016
        - atom: CG2 x: -9.590999603271484 y:-7.790999889373779 z:26.69499969482422
      - residue GLY has 4 atoms
        - atom: N x: -6.26200008392334 y:-5.583000183105469 z:26.841999053955078
        - atom: CA x: -4.89900016784668 y:-6.0329999923706055 z:26.658000946044922
        - atom: C x: -4.8379998207092285 y:-7.366000175476074 z:25.944000244140625
        - atom: O x: -5.651000022888184 y:-7.636000156402588 z:25.055999755859375
      - residue SER has 6 atoms
        - atom: N x: -3.8940000534057617 y:-8.215999603271484 z:26.344999313354492
        - atom: CA x: -2.950000047683716 y:-7.925000190734863 z:27.43899917602539
        - atom: C x: -1.9830000400543213 y:-6.807000160217285 z:27.10099983215332
        - atom: O x: -1.75600004196167 y:-6.502999782562256 z:25.93000030517578
        - atom: CB x: -2.1080000400543213 y:-9.154000282287598 z:27.775999069213867
        - atom: OG x: -1.0529999732971191 y:-9.291999816894531 z:26.840999603271484
      - residue ASP has 8 atoms
        - atom: N x: -1.3969999551773071 y:-6.228000164031982 z:28.145000457763672
        - atom: CA x: -0.42899999022483826 y:-5.145999908447266 z:28.013999938964844
        - atom: C x: 0.6370000243186951 y:-5.468999862670898 z:26.96299934387207
        - atom: O x: 0.9330000281333923 y:-4.64900016784668 z:26.097000122070312
        - atom: CB x: 0.22100000083446503 y:-4.900000095367432 z:29.3700008392334
        - atom: CG x: 0.7870000004768372 y:-6.170000076293945 z:29.974000930786133
        - atom: OD1 x: 1.9320000410079956 y:-6.541999816894531 z:29.61400032043457
        - atom: OD2 x: 0.07400000095367432 y:-6.804999828338623 z:30.790000915527344
      - residue ILE has 8 atoms
        - atom: N x: 1.215999960899353 y:-6.6620001792907715 z:27.04199981689453
        - atom: CA x: 2.2239999771118164 y:-7.057000160217285 z:26.06999969482422
        - atom: C x: 1.5240000486373901 y:-7.189000129699707 z:24.72800064086914
        - atom: O x: 2.115000009536743 y:-6.8979997634887695 z:23.695999145507812
        - atom: CB x: 2.88700008392334 y:-8.416000366210938 z:26.416000366210938
        - atom: CG1 x: 3.5199999809265137 y:-8.373000144958496 z:27.809999465942383
        - atom: CG2 x: 3.9570000171661377 y:-8.734999656677246 z:25.385000228881836
        - atom: CD1 x: 4.730000019073486 y:-7.460999965667725 z:27.913000106811523
      - residue PHE has 11 atoms
        - atom: N x: 0.27000001072883606 y:-7.638999938964844 z:24.740999221801758
        - atom: CA x: -0.4909999966621399 y:-7.76800012588501 z:23.500999450683594
        - atom: C x: -0.550000011920929 y:-6.389999866485596 z:22.841999053955078
        - atom: O x: -0.3019999861717224 y:-6.252999782562256 z:21.641000747680664
        - atom: CB x: -1.9140000343322754 y:-8.26200008392334 z:23.777000427246094
        - atom: CG x: -2.802999973297119 y:-8.269000053405762 z:22.55900001525879
        - atom: CD1 x: -4.051000118255615 y:-7.645999908447266 z:22.586000442504883
        - atom: CD2 x: -2.3959999084472656 y:-8.892999649047852 z:21.381999969482422
        - atom: CE1 x: -4.880000114440918 y:-7.64300012588501 z:21.461000442504883
        - atom: CE2 x: -3.2209999561309814 y:-8.895000457763672 z:20.25200080871582
        - atom: CZ x: -4.4629998207092285 y:-8.267000198364258 z:20.29599952697754
      - residue ASN has 8 atoms
        - atom: N x: -0.8730000257492065 y:-5.379000186920166 z:23.64900016784668
        - atom: CA x: -0.9649999737739563 y:-3.994999885559082 z:23.198999404907227
        - atom: C x: 0.36899998784065247 y:-3.4709999561309814 z:22.68199920654297
        - atom: O x: 0.4090000092983246 y:-2.625 z:21.791000366210938
        - atom: CB x: -1.4759999513626099 y:-3.121000051498413 z:24.334999084472656
        - atom: CG x: -2.9230000972747803 y:-3.3919999599456787 z:24.648000717163086
        - atom: OD1 x: -3.4649999141693115 y:-4.428999900817871 z:24.25200080871582
        - atom: ND2 x: -3.565000057220459 y:-2.4709999561309814 z:25.361000061035156
      - residue LYS has 9 atoms
        - atom: N x: 1.4589999914169312 y:-3.9660000801086426 z:23.25200080871582
        - atom: CA x: 2.7829999923706055 y:-3.575000047683716 z:22.798999786376953
        - atom: C x: 2.8970000743865967 y:-4.184000015258789 z:21.39900016784668
        - atom: O x: 3.390000104904175 y:-3.553999900817871 z:20.46500015258789
        - atom: CB x: 3.865000009536743 y:-4.192999839782715 z:23.691999435424805
        - atom: CG x: 4.803999900817871 y:-3.2190001010894775 z:24.374000549316406
        - atom: CD x: 4.2220001220703125 y:-2.7219998836517334 z:25.68199920654297
        - atom: CE x: 5.249000072479248 y:-1.906999945640564 z:26.447999954223633
        - atom: NZ x: 4.71999979019165 y:-1.440000057220459 z:27.759000778198242
      - residue ASN has 8 atoms
        - atom: N x: 2.4240000247955322 y:-5.421000003814697 z:21.270999908447266
        - atom: CA x: 2.4730000495910645 y:-6.144999980926514 z:20.006000518798828
        - atom: C x: 1.680999994277954 y:-5.458000183105469 z:18.91900062561035
        - atom: O x: 2.183000087738037 y:-5.236999988555908 z:17.82200050354004
        - atom: CB x: 1.9279999732971191 y:-7.566999912261963 z:20.170000076293945
        - atom: CG x: 2.819000005722046 y:-8.437000274658203 z:21.020999908447266
        - atom: OD1 x: 4.0329999923706055 y:-8.473999977111816 z:20.822999954223633
        - atom: ND2 x: 2.2230000495910645 y:-9.152000427246094 z:21.969999313354492
      - residue MET has 8 atoms
        - atom: N x: 0.43299999833106995 y:-5.135000228881836 z:19.23699951171875
        - atom: CA x: -0.46299999952316284 y:-4.486000061035156 z:18.29400062561035
        - atom: C x: -0.013000000268220901 y:-3.0759999752044678 z:17.910999298095703
        - atom: O x: 0.13500000536441803 y:-2.7690000534057617 z:16.731000900268555
        - atom: CB x: -1.8730000257492065 y:-4.451000213623047 z:18.875
        - atom: CG x: -2.9140000343322754 y:-3.936000108718872 z:17.91699981689453
        - atom: SD x: -4.511000156402588 y:-3.989000082015991 z:18.68199920654297
        - atom: CE x: -5.236000061035156 y:-5.382999897003174 z:17.812000274658203
      - residue ARG has 11 atoms
        - atom: N x: 0.20499999821186066 y:-2.2179999351501465 z:18.899999618530273
        - atom: CA x: 0.6489999890327454 y:-0.8560000061988831 z:18.618000030517578
        - atom: C x: 2.0329999923706055 y:-0.8849999904632568 z:17.986000061035156
        - atom: O x: 2.75600004196167 y:0.10899999737739563 z:18.027000427246094
        - atom: CB x: 0.7039999961853027 y:-0.02199999988079071 z:19.905000686645508
        - atom: CG x: -0.6389999985694885 y:0.16200000047683716 z:20.607999801635742
        - atom: CD x: -0.546999990940094 y:1.11899995803833 z:21.801000595092773
        - atom: NE x: 0.36800000071525574 y:0.6430000066757202 z:22.839000701904297
        - atom: CZ x: 1.690000057220459 y:0.8040000200271606 z:22.823999404907227
        - atom: NH1 x: 2.2869999408721924 y:1.440999984741211 z:21.822999954223633
        - atom: NH2 x: 2.4210000038146973 y:0.3109999895095825 z:23.812000274658203
      - residue ALA has 5 atoms
        - atom: N x: 2.3959999084472656 y:-2.0299999713897705 z:17.41200065612793
        - atom: CA x: 3.694999933242798 y:-2.2079999446868896 z:16.777000427246094
        - atom: C x: 3.558000087738037 y:-2.7639999389648438 z:15.357999801635742
        - atom: O x: 4.267000198364258 y:-2.3389999866485596 z:14.446999549865723
        - atom: CB x: 4.560999870300293 y:-3.131999969482422 z:17.625
      - residue HIS has 10 atoms
        - atom: N x: 2.6530001163482666 y:-3.7170000076293945 z:15.168000221252441
        - atom: CA x: 2.447000026702881 y:-4.2870001792907715 z:13.842000007629395
        - atom: C x: 1.50600004196167 y:-3.38100004196167 z:13.050000190734863
        - atom: O x: 1.3990000486373901 y:-3.496000051498413 z:11.829999923706055
        - atom: CB x: 1.8489999771118164 y:-5.692999839782715 z:13.930999755859375
        - atom: CG x: 2.2960000038146973 y:-6.5980000495910645 z:12.826000213623047
        - atom: ND1 x: 3.5880000591278076 y:-7.076000213623047 z:12.737000465393066
        - atom: CD2 x: 1.6419999599456787 y:-7.076000213623047 z:11.741000175476074
        - atom: CE1 x: 3.7090001106262207 y:-7.809999942779541 z:11.645000457763672
        - atom: NE2 x: 2.5429999828338623 y:-7.827000141143799 z:11.02299976348877
      - residue ALA has 5 atoms
        - atom: N x: 0.828000009059906 y:-2.4809999465942383 z:13.76200008392334
        - atom: CA x: -0.10000000149011612 y:-1.5369999408721924 z:13.149999618530273
        - atom: C x: 0.6909999847412109 y:-0.40799999237060547 z:12.517999649047852
        - atom: O x: 0.12399999797344208 y:0.5239999890327454 z:11.958000183105469
        - atom: CB x: -1.0499999523162842 y:-0.9750000238418579 z:14.199999809265137
      - residue LEU has 8 atoms
        - atom: N x: 2.009999990463257 y:-0.4959999918937683 z:12.625
        - atom: CA x: 2.8910000324249268 y:0.5099999904632568 z:12.059000015258789
        - atom: C x: 3.50600004196167 y:-0.03500000014901161 z:10.78499984741211
        - atom: O x: 3.7899999618530273 y:0.7179999947547913 z:9.859999656677246
        - atom: CB x: 3.9809999465942383 y:0.875 z:13.062000274658203
        - atom: CG x: 3.4670000076293945 y:1.5980000495910645 z:14.305000305175781
        - atom: CD1 x: 4.455999851226807 y:1.4429999589920044 z:15.440999984741211
        - atom: CD2 x: 3.243000030517578 y:3.062999963760376 z:13.977999687194824
      - residue GLU has 9 atoms
        - atom: N x: 3.7119998931884766 y:-1.3480000495910645 z:10.744999885559082
        - atom: CA x: 4.270999908447266 y:-2.0 z:9.562999725341797
        - atom: C x: 3.1630001068115234 y:-2.0859999656677246 z:8.519000053405762
        - atom: O x: 3.4089999198913574 y:-2.381999969482422 z:7.3460001945495605
        - atom: CB x: 4.775000095367432 y:-3.4110000133514404 z:9.897000312805176
        - atom: CG x: 6.122000217437744 y:-3.4679999351501465 z:10.611000061035156
        - atom: CD x: 6.538000106811523 y:-4.894000053405762 z:10.965999603271484
        - atom: OE1 x: 5.827000141143799 y:-5.545000076293945 z:11.767999649047852
        - atom: OE2 x: 7.573999881744385 y:-5.364999771118164 z:10.442000389099121
      - residue LYS has 9 atoms
        - atom: N x: 1.937000036239624 y:-1.8250000476837158 z:8.96399974822998
        - atom: CA x: 0.7760000228881836 y:-1.8489999771118164 z:8.09000015258789
        - atom: C x: 0.4650000035762787 y:-0.4359999895095825 z:7.625
        - atom: O x: -0.1469999998807907 y:-0.23800000548362732 z:6.577000141143799
        - atom: CB x: -0.42500001192092896 y:-2.430999994277954 z:8.829000473022461
        - atom: CG x: -0.34700000286102295 y:-3.931999921798706 z:9.03600025177002
        - atom: CD x: -0.3109999895095825 y:-4.669000148773193 z:7.701000213623047
        - atom: CE x: -0.36899998784065247 y:-6.182000160217285 z:7.88100004196167
        - atom: NZ x: -0.4009999930858612 y:-6.886000156402588 z:6.570000171661377
      - residue GLY has 4 atoms
        - atom: N x: 0.8970000147819519 y:0.5450000166893005 z:8.40999984741211
        - atom: CA x: 0.6600000262260437 y:1.930999994277954 z:8.053999900817871
        - atom: C x: -0.44699999690055847 y:2.5869998931884766 z:8.862000465393066
        - atom: O x: -1.2719999551773071 y:3.318000078201294 z:8.3100004196167
      - residue PHE has 11 atoms
        - atom: N x: -0.4729999899864197 y:2.3239998817443848 z:10.166999816894531
        - atom: CA x: -1.4789999723434448 y:2.8940000534057617 z:11.060999870300293
        - atom: C x: -0.8289999961853027 y:3.25 z:12.390000343322754
        - atom: O x: 0.3659999966621399 y:3.0260000228881836 z:12.576000213623047
        - atom: CB x: -2.614000082015991 y:1.8949999809265137 z:11.293999671936035
        - atom: CG x: -3.365000009536743 y:1.534999966621399 z:10.04699993133545
        - atom: CD1 x: -2.7880001068115234 y:0.7170000076293945 z:9.079999923706055
        - atom: CD2 x: -4.638999938964844 y:2.0510001182556152 z:9.812999725341797
        - atom: CE1 x: -3.4639999866485596 y:0.42100000381469727 z:7.896999835968018
        - atom: CE2 x: -5.323999881744385 y:1.7610000371932983 z:8.633999824523926
        - atom: CZ x: -4.734000205993652 y:0.9449999928474426 z:7.675000190734863
      - residue THR has 7 atoms
        - atom: N x: -1.6059999465942383 y:3.812999963760376 z:13.309000015258789
        - atom: CA x: -1.0820000171661377 y:4.171000003814697 z:14.621000289916992
        - atom: C x: -2.1449999809265137 y:4.130000114440918 z:15.713000297546387
        - atom: O x: -2.8350000381469727 y:5.118000030517578 z:15.982999801635742
        - atom: CB x: -0.4440000057220459 y:5.560999870300293 z:14.616999626159668
        - atom: OG1 x: -0.1979999989271164 y:5.96999979019165 z:15.970999717712402
        - atom: CG2 x: -1.3569999933242798 y:6.568999767303467 z:13.937999725341797
      - residue ILE has 8 atoms
        - atom: N x: -2.260999917984009 y:2.9660000801086426 z:16.34000015258789
        - atom: CA x: -3.2179999351501465 y:2.749000072479248 z:17.410999298095703
        - atom: C x: -2.7730000019073486 y:3.4049999713897705 z:18.715999603271484
        - atom: O x: -1.5839999914169312 y:3.5250000953674316 z:18.99799919128418
        - atom: CB x: -3.384000062942505 y:1.25 z:17.70800018310547
        - atom: CG1 x: -3.8320000171661377 y:0.5090000033378601 z:16.45400047302246
        - atom: CG2 x: -4.36899995803833 y:1.0549999475479126 z:18.841999053955078
        - atom: CD1 x: -3.9230000972747803 y:-0.9929999709129333 z:16.635000228881836
      - residue ASN has 8 atoms
        - atom: N x: -3.750999927520752 y:3.8329999446868896 z:19.49799919128418
        - atom: CA x: -3.5160000324249268 y:4.416999816894531 z:20.804000854492188
        - atom: C x: -4.771999835968018 y:3.9769999980926514 z:21.53499984741211
        - atom: O x: -5.671000003814697 y:3.4179999828338623 z:20.91699981689453
        - atom: CB x: -3.364000082015991 y:5.951000213623047 z:20.72800064086914
        - atom: CG x: -4.677000045776367 y:6.679999828338623 z:20.570999145507812
        - atom: OD1 x: -5.383999824523926 y:6.507999897003174 z:19.586000442504883
        - atom: ND2 x: -5.002999782562256 y:7.520999908447266 z:21.547000885009766
      - residue GLU has 9 atoms
        - atom: N x: -4.8480000495910645 y:4.176000118255615 z:22.83799934387207
        - atom: CA x: -6.034999847412109 y:3.7279999256134033 z:23.54800033569336
        - atom: C x: -7.315999984741211 y:4.426000118255615 z:23.10700035095215
        - atom: O x: -8.413999557495117 y:4.002999782562256 z:23.4689998626709
        - atom: CB x: -5.839000225067139 y:3.9059998989105225 z:25.049999237060547
        - atom: CG x: -5.285999774932861 y:5.250999927520752 z:25.452999114990234
        - atom: CD x: -5.427000045776367 y:5.492000102996826 z:26.93899917602539
        - atom: OE1 x: -6.584000110626221 y:5.568999767303467 z:27.41699981689453
        - atom: OE2 x: -4.386000156402588 y:5.5960001945495605 z:27.628999710083008
      - residue TYR has 12 atoms
        - atom: N x: -7.186999797821045 y:5.4730000495910645 z:22.301000595092773
        - atom: CA x: -8.359000205993652 y:6.21999979019165 z:21.871999740600586
        - atom: C x: -8.829000473022461 y:6.129000186920166 z:20.430999755859375
        - atom: O x: -10.012999534606934 y:6.314000129699707 z:20.163000106811523
        - atom: CB x: -8.189000129699707 y:7.686999797821045 z:22.2549991607666
        - atom: CG x: -8.407999992370605 y:7.910999774932861 z:23.726999282836914
        - atom: CD1 x: -9.579999923706055 y:7.461999893188477 z:24.343000411987305
        - atom: CD2 x: -7.442999839782715 y:8.538999557495117 z:24.511999130249023
        - atom: CE1 x: -9.788999557495117 y:7.626999855041504 z:25.70400047302246
        - atom: CE2 x: -7.639999866485596 y:8.711000442504883 z:25.878999710083008
        - atom: CZ x: -8.817999839782715 y:8.24899959564209 z:26.469999313354492
        - atom: OH x: -9.015999794006348 y:8.385000228881836 z:27.82900047302246
      - residue THR has 7 atoms
        - atom: N x: -7.926000118255615 y:5.84499979019165 z:19.503999710083008
        - atom: CA x: -8.315999984741211 y:5.76200008392334 z:18.10300064086914
        - atom: C x: -7.355000019073486 y:4.928999900817871 z:17.274999618530273
        - atom: O x: -6.382999897003174 y:4.380000114440918 z:17.781999588012695
        - atom: CB x: -8.359000205993652 y:7.159999847412109 z:17.450000762939453
        - atom: OG1 x: -7.072000026702881 y:7.771999835968018 z:17.58099937438965
        - atom: CG2 x: -9.40999984741211 y:8.045999526977539 z:18.10300064086914
      - residue ILE has 8 atoms
        - atom: N x: -7.651000022888184 y:4.840000152587891 z:15.984999656677246
        - atom: CA x: -6.809999942779541 y:4.129000186920166 z:15.03600025177002
        - atom: C x: -6.605000019073486 y:5.14300012588501 z:13.92300033569336
        - atom: O x: -7.561999797821045 y:5.546000003814697 z:13.265999794006348
        - atom: CB x: -7.505000114440918 y:2.8489999771118164 z:14.496000289916992
        - atom: CG1 x: -6.677000045776367 y:2.243000030517578 z:13.366000175476074
        - atom: CG2 x: -8.907999992370605 y:3.1640000343322754 z:14.024999618530273
        - atom: CD1 x: -5.2870001792907715 y:1.8519999980926514 z:13.770000457763672
      - residue ARG has 11 atoms
        - atom: N x: -5.361999988555908 y:5.576000213623047 z:13.73900032043457
        - atom: CA x: -5.0320000648498535 y:6.578000068664551 z:12.72599983215332
        - atom: C x: -4.03000020980835 y:6.0970001220703125 z:11.682000160217285
        - atom: O x: -3.0840001106262207 y:5.367000102996826 z:11.996000289916992
        - atom: CB x: -4.446000099182129 y:7.829999923706055 z:13.387999534606934
        - atom: CG x: -5.349999904632568 y:8.541000366210938 z:14.371999740600586
        - atom: CD x: -4.564000129699707 y:9.571000099182129 z:15.16100025177002
        - atom: NE x: -5.436999797821045 y:10.416000366210938 z:15.961999893188477
        - atom: CZ x: -6.255000114440918 y:11.333999633789062 z:15.456000328063965
        - atom: NH1 x: -6.309000015258789 y:11.53499984741211 z:14.142999649047852
        - atom: NH2 x: -7.034999847412109 y:12.043000221252441 z:16.260000228881836
      - residue PRO has 7 atoms
        - atom: N x: -4.21999979019165 y:6.513000011444092 z:10.418999671936035
        - atom: CA x: -3.3289999961853027 y:6.136000156402588 z:9.314000129699707
        - atom: C x: -2.0810000896453857 y:7.013000011444092 z:9.279999732971191
        - atom: O x: -2.1059999465942383 y:8.13700008392334 z:9.77299976348877
        - atom: CB x: -4.203000068664551 y:6.354000091552734 z:8.08899974822998
        - atom: CG x: -5.043000221252441 y:7.53000020980835 z:8.503999710083008
        - atom: CD x: -5.443999767303467 y:7.158999919891357 z:9.90999984741211
      - residue LEU has 8 atoms
        - atom: N x: -0.9909999966621399 y:6.5 z:8.71500015258789
        - atom: CA x: 0.23899999260902405 y:7.2820000648498535 z:8.612000465393066
        - atom: C x: 0.4749999940395355 y:7.710999965667725 z:7.160999774932861
        - atom: O x: 0.6140000224113464 y:6.875999927520752 z:6.260000228881836
        - atom: CB x: 1.4550000429153442 y:6.493000030517578 z:9.128000259399414
        - atom: CG x: 1.6330000162124634 y:6.239999771118164 z:10.633000373840332
        - atom: CD1 x: 3.072000026702881 y:5.822000026702881 z:10.888999938964844
        - atom: CD2 x: 1.3270000219345093 y:7.493000030517578 z:11.430999755859375
      - residue GLY has 4 atoms
        - atom: N x: 0.5199999809265137 y:9.02400016784668 z:6.947000026702881
        - atom: CA x: 0.7110000252723694 y:9.560999870300293 z:5.611999988555908
        - atom: C x: 2.055000066757202 y:9.293999671936035 z:4.956999778747559
        - atom: O x: 2.5769999027252197 y:8.173999786376953 z:5.01200008392334
      - residue VAL has 5 atoms
        - atom: N x: 2.6010000705718994 y:10.335000038146973 z:4.326000213623047
        - atom: CA x: 3.885999917984009 y:10.26200008392334 z:3.632999897003174
        - atom: C x: 5.041999816894531 y:10.295999526977539 z:4.625999927520752
        - atom: O x: 5.809000015258789 y:9.336999893188477 z:4.73799991607666
        - atom: CB x: 4.046000003814697 y:11.435999870300293 z:2.6449999809265137
      - residue THR has 7 atoms
        - atom: N x: 5.1620001792907715 y:11.411999702453613 z:5.3379998207092285
        - atom: CA x: 6.205999851226807 y:11.58899974822998 z:6.3429999351501465
        - atom: C x: 5.745999813079834 y:10.847000122070312 z:7.5879998207092285
        - atom: O x: 6.538000106811523 y:10.524999618530273 z:8.479999542236328
        - atom: CB x: 6.401000022888184 y:13.09000015258789 z:6.693999767303467
        - atom: OG1 x: 7.418000221252441 y:13.229000091552734 z:7.696000099182129
        - atom: CG2 x: 5.10099983215332 y:13.690999984741211 z:7.216000080108643
      - residue GLY has 4 atoms
        - atom: N x: 4.451000213623047 y:10.559000015258789 z:7.620999813079834
        - atom: CA x: 3.871999979019165 y:9.878999710083008 z:8.756999969482422
        - atom: C x: 3.1549999713897705 y:10.939000129699707 z:9.560999870300293
        - atom: O x: 3.7009999752044678 y:11.47599983215332 z:10.526000022888184
      - residue VAL has 7 atoms
        - atom: N x: 1.9320000410079956 y:11.253999710083008 z:9.142000198364258
        - atom: CA x: 1.121000051498413 y:12.267000198364258 z:9.810999870300293
        - atom: C x: -0.13600000739097595 y:11.644000053405762 z:10.413000106811523
        - atom: O x: -0.7139999866485596 y:10.715999603271484 z:9.848999977111816
        - atom: CB x: 0.6930000185966492 y:13.37600040435791 z:8.821000099182129
        - atom: CG1 x: 0.11800000071525574 y:14.564000129699707 z:9.583999633789062
        - atom: CG2 x: 1.8819999694824219 y:13.795000076293945 z:7.960999965667725
      - residue ALA has 5 atoms
        - atom: N x: -0.5550000071525574 y:12.157999992370605 z:11.562000274658203
        - atom: CA x: -1.746000051498413 y:11.645999908447266 z:12.223999977111816
        - atom: C x: -2.989000082015991 y:11.880000114440918 z:11.366999626159668
        - atom: O x: -3.7219998836517334 y:12.854999542236328 z:11.567999839782715
        - atom: CB x: -1.9160000085830688 y:12.317000389099121 z:13.588000297546387
      - residue GLY has 4 atoms
        - atom: N x: -3.2219998836517334 y:10.994000434875488 z:10.402999877929688
        - atom: CA x: -4.394999980926514 y:11.140999794006348 z:9.5649995803833
        - atom: C x: -5.603000164031982 y:11.170000076293945 z:10.477999687194824
        - atom: O x: -5.493000030517578 y:10.807000160217285 z:11.645999908447266
      - residue GLU has 9 atoms
        - atom: N x: -6.754000186920166 y:11.597999572753906 z:9.97599983215332
        - atom: CA x: -7.928999900817871 y:11.63700008392334 z:10.82699966430664
        - atom: C x: -8.236000061035156 y:10.243000030517578 z:11.357999801635742
        - atom: O x: -7.811999797821045 y:9.243000030517578 z:10.781999588012695
        - atom: CB x: -9.128000259399414 y:12.204000473022461 z:10.067999839782715
        - atom: CG x: -8.973999977111816 y:13.675999641418457 z:9.729000091552734
        - atom: CD x: -8.668999671936035 y:14.520999908447266 z:10.954000473022461
        - atom: OE1 x: -9.545999526977539 y:14.63599967956543 z:11.836999893188477
        - atom: OE2 x: -7.546000003814697 y:15.064000129699707 z:11.038999557495117
      - residue PRO has 7 atoms
        - atom: N x: -8.956999778747559 y:10.168000221252441 z:12.486000061035156
        - atom: CA x: -9.35099983215332 y:8.928999900817871 z:13.156000137329102
        - atom: C x: -10.333999633789062 y:8.079000473022461 z:12.36299991607666
        - atom: O x: -11.458999633789062 y:8.48799991607666 z:12.119999885559082
        - atom: CB x: -9.963000297546387 y:9.427000045776367 z:14.458000183105469
        - atom: CG x: -9.27299976348877 y:10.722000122070312 z:14.6899995803833
        - atom: CD x: -9.281999588012695 y:11.329000473022461 z:13.32800006866455
      - residue LEU has 8 atoms
        - atom: N x: -9.914999961853027 y:6.882999897003174 z:11.980999946594238
        - atom: CA x: -10.781000137329102 y:5.994999885559082 z:11.220000267028809
        - atom: C x: -12.0 y:5.538000106811523 z:12.052000045776367
        - atom: O x: -11.925000190734863 y:5.4029998779296875 z:13.284000396728516
        - atom: CB x: -9.970000267028809 y:4.785999774932861 z:10.727999687194824
        - atom: CG x: -8.637999534606934 y:5.125 z:10.034000396728516
        - atom: CD1 x: -7.88100004196167 y:3.8529999256134033 z:9.711999893188477
        - atom: CD2 x: -8.88599967956543 y:5.926000118255615 z:8.770999908447266
      - residue PRO has 7 atoms
        - atom: N x: -13.142999649047852 y:5.301000118255615 z:11.381999969482422
        - atom: CA x: -14.369999885559082 y:4.864999771118164 z:12.055999755859375
        - atom: C x: -14.175000190734863 y:3.4600000381469727 z:12.61299991607666
        - atom: O x: -13.482000350952148 y:2.6470000743865967 z:12.015000343322754
        - atom: CB x: -15.402999877929688 y:4.925000190734863 z:10.942999839782715
        - atom: CG x: -14.595000267028809 y:4.534999847412109 z:9.737000465393066
        - atom: CD x: -13.314000129699707 y:5.303999900817871 z:9.918000221252441
      - residue VAL has 7 atoms
        - atom: N x: -14.791000366210938 y:3.1710000038146973 z:13.751999855041504
        - atom: CA x: -14.619999885559082 y:1.871999979019165 z:14.383999824523926
        - atom: C x: -15.878000259399414 y:1.4279999732971191 z:15.11400032043457
        - atom: O x: -16.320999145507812 y:2.0989999771118164 z:16.045000076293945
        - atom: CB x: -13.45199966430664 y:1.9279999732971191 z:15.414999961853027
        - atom: CG1 x: -13.395000457763672 y:0.6629999876022339 z:16.229000091552734
        - atom: CG2 x: -12.142000198364258 y:2.13700008392334 z:14.706000328063965
      - residue ASP has 8 atoms
        - atom: N x: -16.44499969482422 y:0.29499998688697815 z:14.708000183105469
        - atom: CA x: -17.641000747680664 y:-0.2070000022649765 z:15.37600040435791
        - atom: C x: -17.44300079345703 y:-1.562000036239624 z:16.04199981689453
        - atom: O x: -18.38599967956543 y:-2.1410000324249268 z:16.584999084472656
        - atom: CB x: -18.812000274658203 y:-0.27399998903274536 z:14.397000312805176
        - atom: CG x: -19.378000259399414 y:1.090999960899353 z:14.090999603271484
        - atom: OD1 x: -19.974000930786133 y:1.7089999914169312 z:15.01099967956543
        - atom: OD2 x: -19.208999633789062 y:1.5449999570846558 z:12.937000274658203
      - residue SER has 6 atoms
        - atom: N x: -16.21299934387207 y:-2.056999921798706 z:16.011999130249023
        - atom: CA x: -15.904000282287598 y:-3.3350000381469727 z:16.624000549316406
        - atom: C x: -14.416999816894531 y:-3.440999984741211 z:16.860000610351562
        - atom: O x: -13.630000114440918 y:-2.6700000762939453 z:16.297000885009766
        - atom: CB x: -16.336000442504883 y:-4.482999801635742 z:15.71399974822998
        - atom: OG x: -15.477999687194824 y:-4.5929999351501465 z:14.583999633789062
      - residue GLU has 9 atoms
        - atom: N x: -14.02299976348877 y:-4.389999866485596 z:17.70199966430664
        - atom: CA x: -12.605999946594238 y:-4.583000183105469 z:17.94700050354004
        - atom: C x: -12.114999771118164 y:-5.175000190734863 z:16.631000518798828
        - atom: O x: -11.086999893188477 y:-4.754000186920166 z:16.094999313354492
        - atom: CB x: -12.359999656677246 y:-5.572000026702881 z:19.093000411987305
        - atom: CG x: -12.958000183105469 y:-5.177999973297119 z:20.433000564575195
        - atom: CD x: -12.744000434875488 y:-6.241000175476074 z:21.503000259399414
        - atom: OE1 x: -11.678000450134277 y:-6.239999771118164 z:22.149999618530273
        - atom: OE2 x: -13.63700008392334 y:-7.091000080108643 z:21.690000534057617
      - residue LYS has 9 atoms
        - atom: N x: -12.881999969482422 y:-6.133999824523926 z:16.10300064086914
        - atom: CA x: -12.550999641418457 y:-6.808000087738037 z:14.845000267028809
        - atom: C x: -12.190999984741211 y:-5.770999908447266 z:13.795000076293945
        - atom: O x: -11.251999855041504 y:-5.955999851226807 z:13.017000198364258
        - atom: CB x: -13.72700023651123 y:-7.6579999923706055 z:14.350000381469727
        - atom: CG x: -13.319999694824219 y:-8.717000007629395 z:13.312999725341797
        - atom: CD x: -14.470999717712402 y:-9.666000366210938 z:12.951000213623047
        - atom: CE x: -13.95300006866455 y:-10.96500015258789 z:12.319999694824219
        - atom: NZ x: -13.071999549865723 y:-10.746999740600586 z:11.128999710083008
      - residue ASP has 8 atoms
        - atom: N x: -12.949999809265137 y:-4.681000232696533 z:13.784000396728516
        - atom: CA x: -12.708999633789062 y:-3.5869998931884766 z:12.864999771118164
        - atom: C x: -11.27299976348877 y:-3.0889999866485596 z:12.994000434875488
        - atom: O x: -10.62399959564209 y:-2.819999933242798 z:11.98799991607666
        - atom: CB x: -13.6850004196167 y:-2.4489998817443848 z:13.14900016784668
        - atom: CG x: -15.019000053405762 y:-2.638000011444092 z:12.45199966430664
        - atom: OD1 x: -15.416999816894531 y:-3.799999952316284 z:12.22700023651123
        - atom: OD2 x: -15.673999786376953 y:-1.6230000257492065 z:12.137999534606934
      - residue ILE has 8 atoms
        - atom: N x: -10.767000198364258 y:-2.9700000286102295 z:14.220000267028809
        - atom: CA x: -9.394000053405762 y:-2.506999969482422 z:14.414999961853027
        - atom: C x: -8.388999938964844 y:-3.507999897003174 z:13.859999656677246
        - atom: O x: -7.361000061035156 y:-3.1089999675750732 z:13.307999610900879
        - atom: CB x: -9.074000358581543 y:-2.252000093460083 z:15.904000282287598
        - atom: CG1 x: -9.920999526977539 y:-1.0920000076293945 z:16.42300033569336
        - atom: CG2 x: -7.604000091552734 y:-1.9160000085830688 z:16.07200050354004
        - atom: CD1 x: -9.934000015258789 y:-0.9750000238418579 z:17.92300033569336
      - residue PHE has 11 atoms
        - atom: N x: -8.67199993133545 y:-4.802999973297119 z:13.996999740600586
        - atom: CA x: -7.755000114440918 y:-5.816999912261963 z:13.468000411987305
        - atom: C x: -7.697000026702881 y:-5.741000175476074 z:11.954000473022461
        - atom: O x: -6.613999843597412 y:-5.801000118255615 z:11.366000175476074
        - atom: CB x: -8.1850004196167 y:-7.229000091552734 z:13.838000297546387
        - atom: CG x: -8.031000137329102 y:-7.553999900817871 z:15.281000137329102
        - atom: CD1 x: -8.97599983215332 y:-7.142000198364258 z:16.200000762939453
        - atom: CD2 x: -6.9629998207092285 y:-8.329000473022461 z:15.71399974822998
        - atom: CE1 x: -8.86400032043457 y:-7.50600004196167 z:17.531999588012695
        - atom: CE2 x: -6.8420000076293945 y:-8.699000358581543 z:17.04400062561035
        - atom: CZ x: -7.793000221252441 y:-8.289999961853027 z:17.95400047302246
      - residue ASP has 8 atoms
        - atom: N x: -8.868000030517578 y:-5.627999782562256 z:11.32800006866455
        - atom: CA x: -8.956000328063965 y:-5.539999961853027 z:9.875
        - atom: C x: -7.9770002365112305 y:-4.494999885559082 z:9.343000411987305
        - atom: O x: -7.117000102996826 y:-4.798999786376953 z:8.513999938964844
        - atom: CB x: -10.378999710083008 y:-5.177999973297119 z:9.451000213623047
        - atom: CG x: -11.38599967956543 y:-6.243000030517578 z:9.824000358581543
        - atom: OD1 x: -11.04800033569336 y:-7.438000202178955 z:9.717000007629395
        - atom: OD2 x: -12.520000457763672 y:-5.888000011444092 z:10.206999778747559
      - residue TYR has 12 atoms
        - atom: N x: -8.109999656677246 y:-3.2669999599456787 z:9.835000038146973
        - atom: CA x: -7.236000061035156 y:-2.171999931335449 z:9.430000305175781
        - atom: C x: -5.750999927520752 y:-2.553999900817871 z:9.388999938964844
        - atom: O x: -5.015999794006348 y:-2.0889999866485596 z:8.51200008392334
        - atom: CB x: -7.4120001792907715 y:-0.9829999804496765 z:10.37600040435791
        - atom: CG x: -8.711999893188477 y:-0.2290000021457672 z:10.222999572753906
        - atom: CD1 x: -8.961999893188477 y:0.5600000023841858 z:9.097999572753906
        - atom: CD2 x: -9.673999786376953 y:-0.26100000739097595 z:11.227999687194824
        - atom: CE1 x: -10.13700008392334 y:1.3040000200271606 z:8.98799991607666
        - atom: CE2 x: -10.85200023651123 y:0.4740000069141388 z:11.125
        - atom: CZ x: -11.074000358581543 y:1.253999948501587 z:10.008000373840332
        - atom: OH x: -12.22599983215332 y:1.99399995803833 z:9.934000015258789
      - residue ILE has 8 atoms
        - atom: N x: -5.306000232696533 y:-3.385999917984009 z:10.331999778747559
        - atom: CA x: -3.9000000953674316 y:-3.7909998893737793 z:10.378999710083008
        - atom: C x: -3.6470000743865967 y:-5.202000141143799 z:9.848999977111816
        - atom: O x: -2.5460000038146973 y:-5.744999885559082 z:9.998000144958496
        - atom: CB x: -3.3369998931884766 y:-3.7060000896453857 z:11.810999870300293
        - atom: CG1 x: -4.114999771118164 y:-4.64900016784668 z:12.734999656677246
        - atom: CG2 x: -3.4070000648498535 y:-2.2730000019073486 z:12.29800033569336
        - atom: CD1 x: -3.5190000534057617 y:-4.806000232696533 z:14.109000205993652
      - residue GLN has 9 atoms
        - atom: N x: -4.672999858856201 y:-5.791999816894531 z:9.23799991607666
        - atom: CA x: -4.566999912261963 y:-7.129000186920166 z:8.661999702453613
        - atom: C x: -3.9079999923706055 y:-8.130999565124512 z:9.602999687194824
        - atom: O x: -2.7799999713897705 y:-8.581999778747559 z:9.387999534606934
        - atom: CB x: -3.802999973297119 y:-7.051000118255615 z:7.3420000076293945
        - atom: CG x: -4.520999908447266 y:-6.198999881744385 z:6.308000087738037
        - atom: CD x: -3.6029999256134033 y:-5.708000183105469 z:5.218999862670898
        - atom: OE1 x: -2.9730000495910645 y:-6.502999782562256 z:4.520999908447266
        - atom: NE2 x: -3.515000104904175 y:-4.388000011444092 z:5.065999984741211
      - residue TRP has 14 atoms
        - atom: N x: -4.6479997634887695 y:-8.468000411987305 z:10.651000022888184
        - atom: CA x: -4.2129998207092285 y:-9.406999588012695 z:11.666000366210938
        - atom: C x: -5.4029998779296875 y:-10.319000244140625 z:11.925000190734863
        - atom: O x: -6.546999931335449 y:-9.857000350952148 z:11.963000297546387
        - atom: CB x: -3.867000102996826 y:-8.654000282287598 z:12.949999809265137
        - atom: CG x: -2.4119999408721924 y:-8.647000312805176 z:13.345000267028809
        - atom: CD1 x: -1.3270000219345093 y:-8.75100040435791 z:12.519000053405762
        - atom: CD2 x: -1.8910000324249268 y:-8.4350004196167 z:14.666000366210938
        - atom: NE1 x: -0.164000004529953 y:-8.61299991607666 z:13.244999885559082
        - atom: CE2 x: -0.4819999933242798 y:-8.416000366210938 z:14.562999725341797
        - atom: CE3 x: -2.4809999465942383 y:-8.253999710083008 z:15.925999641418457
        - atom: CZ2 x: 0.34700000286102295 y:-8.222999572753906 z:15.670999526977539
        - atom: CZ3 x: -1.6579999923706055 y:-8.062000274658203 z:17.027000427246094
        - atom: CH2 x: -0.257999986410141 y:-8.04800033569336 z:16.891000747680664
      - residue LYS has 9 atoms
        - atom: N x: -5.131999969482422 y:-11.611000061035156 z:12.079999923706055
        - atom: CA x: -6.172999858856201 y:-12.593999862670898 z:12.36400032043457
        - atom: C x: -6.895999908447266 y:-12.119000434875488 z:13.630999565124512
        - atom: O x: -6.25 y:-11.840999603271484 z:14.640000343322754
        - atom: CB x: -5.515999794006348 y:-13.961000442504883 z:12.612000465393066
        - atom: CG x: -6.453999996185303 y:-15.081999778747559 z:13.057999610900879
        - atom: CD x: -5.710000038146973 y:-16.18600082397461 z:13.833000183105469
        - atom: CE x: -4.585000038146973 y:-16.8439998626709 z:13.029000282287598
        - atom: NZ x: -3.36299991607666 y:-15.994999885559082 z:12.892999649047852
      - residue TYR has 12 atoms
        - atom: N x: -8.222000122070312 y:-12.010000228881836 z:13.583000183105469
        - atom: CA x: -8.960000038146973 y:-11.565999984741211 z:14.760000228881836
        - atom: C x: -8.760000228881836 y:-12.576000213623047 z:15.869999885559082
        - atom: O x: -8.963000297546387 y:-13.774999618530273 z:15.677000045776367
        - atom: CB x: -10.458000183105469 y:-11.418999671936035 z:14.470000267028809
        - atom: CG x: -11.286999702453613 y:-11.11299991607666 z:15.708000183105469
        - atom: CD1 x: -10.930999755859375 y:-10.07800006866455 z:16.576000213623047
        - atom: CD2 x: -12.423999786376953 y:-11.857999801635742 z:16.016000747680664
        - atom: CE1 x: -11.687000274658203 y:-9.791999816894531 z:17.722999572753906
        - atom: CE2 x: -13.187000274658203 y:-11.57800006866455 z:17.160999298095703
        - atom: CZ x: -12.8100004196167 y:-10.543999671936035 z:18.007999420166016
        - atom: OH x: -13.557000160217285 y:-10.265999794006348 z:19.131999969482422
      - residue ARG has 11 atoms
        - atom: N x: -8.35099983215332 y:-12.07800006866455 z:17.030000686645508
        - atom: CA x: -8.109999656677246 y:-12.918000221252441 z:18.19099998474121
        - atom: C x: -9.045999526977539 y:-12.545000076293945 z:19.327999114990234
        - atom: O x: -9.180000305175781 y:-11.371999740600586 z:19.68600082397461
        - atom: CB x: -6.64300012588501 y:-12.793999671936035 z:18.628999710083008
        - atom: CG x: -5.697000026702881 y:-13.623000144958496 z:17.770999908447266
        - atom: CD x: -4.306000232696533 y:-13.03600025177002 z:17.694000244140625
        - atom: NE x: -3.683000087738037 y:-12.902999877929688 z:19.003999710083008
        - atom: CZ x: -2.4519999027252197 y:-12.432999610900879 z:19.19300079345703
        - atom: NH1 x: -1.718999981880188 y:-12.057999610900879 z:18.14900016784668
        - atom: NH2 x: -1.9579999446868896 y:-12.322999954223633 z:20.422000885009766
      - residue GLU has 9 atoms
        - atom: N x: -9.708999633789062 y:-13.553999900817871 z:19.881999969482422
        - atom: CA x: -10.630000114440918 y:-13.32800006866455 z:20.979999542236328
        - atom: C x: -9.880999565124512 y:-12.907999992370605 z:22.240999221801758
        - atom: O x: -8.704000473022461 y:-13.222000122070312 z:22.416000366210938
        - atom: CB x: -11.458000183105469 y:-14.58899974822998 z:21.243000030517578
        - atom: CG x: -12.715999603271484 y:-14.678000450134277 z:20.395999908447266
        - atom: CD x: -13.70300006866455 y:-13.559000015258789 z:20.702999114990234
        - atom: OE1 x: -14.116000175476074 y:-13.442999839782715 z:21.875999450683594
        - atom: OE2 x: -14.069000244140625 y:-12.795999526977539 z:19.7810001373291
      - residue PRO has 7 atoms
        - atom: N x: -10.557000160217285 y:-12.173999786376953 z:23.131999969482422
        - atom: CA x: -9.939000129699707 y:-11.720000267028809 z:24.371000289916992
        - atom: C x: -9.152999877929688 y:-12.814000129699707 z:25.082000732421875
        - atom: O x: -8.093999862670898 y:-12.553000450134277 z:25.649999618530273
        - atom: CB x: -11.133000373840332 y:-11.241999626159668 z:25.18000030517578
        - atom: CG x: -11.991999626159668 y:-10.654999732971191 z:24.128000259399414
        - atom: CD x: -11.949000358581543 y:-11.706999778747559 z:23.049999237060547
      - residue LYS has 9 atoms
        - atom: N x: -9.663999557495117 y:-14.041000366210938 z:25.042999267578125
        - atom: CA x: -8.987000465393066 y:-15.14900016784668 z:25.709999084472656
        - atom: C x: -7.636000156402588 y:-15.522000312805176 z:25.11199951171875
        - atom: O x: -6.769999980926514 y:-16.047000885009766 z:25.81800079345703
        - atom: CB x: -9.890999794006348 y:-16.393999099731445 z:25.76099967956543
        - atom: CG x: -10.576000213623047 y:-16.767000198364258 z:24.45599937438965
        - atom: CD x: -11.342000007629395 y:-18.08099937438965 z:24.591999053955078
        - atom: CE x: -12.46399974822998 y:-18.19700050354004 z:23.55500030517578
        - atom: NZ x: -11.987000465393066 y:-18.033000946044922 z:22.152999877929688
      - residue ASP has 8 atoms
        - atom: N x: -7.442999839782715 y:-15.236000061035156 z:23.82699966430664
        - atom: CA x: -6.190999984741211 y:-15.576000213623047 z:23.158000946044922
        - atom: C x: -5.249000072479248 y:-14.38599967956543 z:23.02199935913086
        - atom: O x: -4.289000034332275 y:-14.437000274658203 z:22.250999450683594
        - atom: CB x: -6.478000164031982 y:-16.13599967956543 z:21.766000747680664
        - atom: CG x: -7.806000232696533 y:-16.85700035095215 z:21.69099998474121
        - atom: OD1 x: -7.918000221252441 y:-17.975000381469727 z:22.240999221801758
        - atom: OD2 x: -8.744000434875488 y:-16.29400062561035 z:21.08300018310547
      - residue ARG has 11 atoms
        - atom: N x: -5.5269999504089355 y:-13.3100004196167 z:23.753000259399414
        - atom: CA x: -4.684999942779541 y:-12.119999885559082 z:23.701000213623047
        - atom: C x: -3.753000020980835 y:-12.059000015258789 z:24.905000686645508
        - atom: O x: -2.9630000591278076 y:-11.131999969482422 z:25.038000106811523
        - atom: CB x: -5.535999774932861 y:-10.854000091552734 z:23.65399932861328
        - atom: CG x: -6.466000080108643 y:-10.753000259399414 z:22.45599937438965
        - atom: CD x: -7.349999904632568 y:-9.517000198364258 z:22.576000213623047
        - atom: NE x: -8.53499984741211 y:-9.595999717712402 z:21.73699951171875
        - atom: CZ x: -9.552000045776367 y:-8.748000144958496 z:21.80900001525879
        - atom: NH1 x: -9.529999732971191 y:-7.751999855041504 z:22.68600082397461
        - atom: NH2 x: -10.593000411987305 y:-8.897000312805176 z:21.003000259399414
      - residue SER has 6 atoms
        - atom: N x: -3.8580000400543213 y:-13.041000366210938 z:25.791000366210938
        - atom: CA x: -2.989000082015991 y:-13.07699966430664 z:26.95599937438965
        - atom: C x: -1.5839999914169312 y:-13.416000366210938 z:26.474000930786133
        - atom: O x: -1.284999966621399 y:-14.574000358581543 z:26.16699981689453
        - atom: CB x: -3.4690001010894775 y:-14.126999855041504 z:27.961000442504883
        - atom: OG x: -4.433000087738037 y:-13.57800006866455 z:28.847000122070312
      - residue GLU has 10 atoms
        - atom: N x: -0.7360000014305115 y:-12.394000053405762 z:26.395999908447266
        - atom: CA x: 0.6309999823570251 y:-12.565999984741211 z:25.93899917602539
        - atom: C x: 1.6269999742507935 y:-11.968999862670898 z:26.92799949645996
        - atom: O x: 2.7279999256134033 y:-12.541000366210938 z:27.077999114990234
        - atom: CB x: 0.7960000038146973 y:-11.9399995803833 z:24.552000045776367
        - atom: CG x: -0.11400000005960464 y:-12.574999809265137 z:23.51099967956543
        - atom: CD x: 0.17499999701976776 y:-12.116999626159668 z:22.09000015258789
        - atom: OE1 x: 0.09000000357627869 y:-10.902999877929688 z:21.815000534057617
        - atom: OE2 x: 0.4819999933242798 y:-12.97700023651123 z:21.23900032043457
        - atom: OXT x: 1.3029999732971191 y:-10.935999870300293 z:27.54400062561035
      - residue MN has 1 atoms
        - atom: MN x: -6.214000225067139 y:-5.52400016784668 z:35.61399841308594
      - residue MN has 1 atoms
        - atom: MN x: -6.142000198364258 y:-2.124000072479248 z:36.37300109863281
      - residue MN has 1 atoms
        - atom: MN x: 13.84000015258789 y:-1.5140000581741333 z:61.231998443603516
      - residue MN has 1 atoms
        - atom: MN x: 8.105999946594238 y:-25.408000946044922 z:15.770000457763672
      - residue NA has 1 atoms
        - atom: NA x: 4.251999855041504 y:-0.11299999803304672 z:43.87799835205078
      - residue NA has 1 atoms
        - atom: NA x: 16.698999404907227 y:-13.654000282287598 z:18.052000045776367
      - residue F2A has 30 atoms
        - atom: PA x: -3.8420000076293945 y:-3.880000114440918 z:34.38800048828125
        - atom: O1A x: -5.063000202178955 y:-3.622999906539917 z:35.20000076293945
        - atom: O2A x: -2.5329999923706055 y:-3.359999895095825 z:34.85300064086914
        - atom: C3A x: -3.6730000972747803 y:-5.749000072479248 z:34.435001373291016
        - atom: O5' x: -4.066999912261963 y:-3.2890000343322754 z:32.92499923706055
        - atom: PB x: -4.76800012588501 y:-7.072999954223633 z:33.6879997253418
        - atom: O1B x: -4.315000057220459 y:-7.23199987411499 z:32.28099822998047
        - atom: O2B x: -6.175000190734863 y:-6.676000118255615 z:33.970001220703125
        - atom: O3B x: -4.465000152587891 y:-8.342000007629395 z:34.42300033569336
        - atom: PG x: -4.432000160217285 y:-8.357000350952148 z:35.915000915527344
        - atom: O1G x: -2.990999937057495 y:-8.444000244140625 z:36.2599983215332
        - atom: O2G x: -5.375 y:-9.385000228881836 z:36.42900085449219
        - atom: O3G x: -4.946000099182129 y:-7.052999973297119 z:36.409000396728516
        - atom: C5' x: -5.205999851226807 y:-3.6419999599456787 z:32.145999908447266
        - atom: C4' x: -4.960000038146973 y:-3.3380000591278076 z:30.687000274658203
        - atom: O4' x: -4.2230000495910645 y:-2.0969998836517334 z:30.54800033569336
        - atom: C1' x: -3.4019999504089355 y:-2.1610000133514404 z:29.38800048828125
        - atom: N9 x: -2.00600004196167 y:-1.9320000410079956 z:29.775999069213867
        - atom: C4 x: -1.0019999742507935 y:-1.4759999513626099 z:28.95199966430664
        - atom: N3 x: -1.1009999513626099 y:-1.1349999904632568 z:27.658000946044922
        - atom: C2 x: 0.08100000023841858 y:-0.7540000081062317 z:27.180999755859375
        - atom: N1 x: 1.2619999647140503 y:-0.6800000071525574 z:27.80299949645996
        - atom: C6 x: 1.3289999961853027 y:-1.0219999551773071 z:29.106000900268555
        - atom: N6 x: 2.506999969482422 y:-0.9359999895095825 z:29.729999542236328
        - atom: C5 x: 0.14499999582767487 y:-1.4479999542236328 z:29.731000900268555
        - atom: N7 x: -0.12700000405311584 y:-1.8680000305175781 z:31.024999618530273
        - atom: C8 x: -1.4129999876022339 y:-2.138000011444092 z:31.003999710083008
        - atom: C2' x: -3.621999979019165 y:-3.5390000343322754 z:28.760000228881836
        - atom: C3' x: -4.086999893188477 y:-4.3429999351501465 z:29.964000701904297
        - atom: O3' x: -4.868000030517578 y:-5.460000038146973 z:29.570999145507812
      - residue HOH has 1 atoms
        - atom: O x: -2.4089999198913574 y:8.484999656677246 z:43.20899963378906
      - residue HOH has 1 atoms
        - atom: O x: -0.14300000667572021 y:-1.7710000276565552 z:48.332000732421875
      - residue HOH has 1 atoms
        - atom: O x: -16.437999725341797 y:-4.840000152587891 z:18.80699920654297
      - residue HOH has 1 atoms
        - atom: O x: 16.079999923706055 y:1.4079999923706055 z:30.270999908447266
      - residue HOH has 1 atoms
        - atom: O x: 21.016000747680664 y:-1.5190000534057617 z:33.81999969482422
      - residue HOH has 1 atoms
        - atom: O x: -6.730999946594238 y:0.6259999871253967 z:20.711999893188477
      - residue HOH has 1 atoms
        - atom: O x: 20.124000549316406 y:-7.186999797821045 z:32.66400146484375
      - residue HOH has 1 atoms
        - atom: O x: -12.125 y:5.327000141143799 z:17.954999923706055
      - residue HOH has 1 atoms
        - atom: O x: -13.345999717712402 y:10.083999633789062 z:45.89799880981445
      - residue HOH has 1 atoms
        - atom: O x: -8.428000450134277 y:6.59499979019165 z:30.35300064086914
      - residue HOH has 1 atoms
        - atom: O x: -18.88599967956543 y:7.940000057220459 z:27.29599952697754
      - residue HOH has 1 atoms
        - atom: O x: -12.711000442504883 y:-14.880000114440918 z:25.305999755859375
      - residue HOH has 1 atoms
        - atom: O x: 13.637999534606934 y:-8.12399959564209 z:24.416000366210938
      - residue HOH has 1 atoms
        - atom: O x: -4.113999843597412 y:-2.135999917984009 z:36.98699951171875
      - residue HOH has 1 atoms
        - atom: O x: 12.25 y:-8.463000297546387 z:47.82099914550781
      - residue HOH has 1 atoms
        - atom: O x: 13.711000442504883 y:2.4779999256134033 z:60.03499984741211
      - residue HOH has 1 atoms
        - atom: O x: 13.440999984741211 y:-24.489999771118164 z:30.077999114990234
      - residue HOH has 1 atoms
        - atom: O x: -1.406000018119812 y:-12.001999855041504 z:50.17599868774414
      - residue HOH has 1 atoms
        - atom: O x: -18.986000061035156 y:-14.868000030517578 z:32.553001403808594
      - residue HOH has 1 atoms
        - atom: O x: -10.734000205993652 y:-14.918000221252441 z:48.27399826049805
      - residue HOH has 1 atoms
        - atom: O x: 11.635000228881836 y:-24.492000579833984 z:31.9689998626709
      - residue HOH has 1 atoms
        - atom: O x: 3.058000087738037 y:-2.069999933242798 z:43.28900146484375
      - residue HOH has 1 atoms
        - atom: O x: 1.7419999837875366 y:-11.512999534606934 z:49.70600128173828
      - residue HOH has 1 atoms
        - atom: O x: -25.611000061035156 y:13.20199966430664 z:33.939998626708984
      - residue HOH has 1 atoms
        - atom: O x: -29.035999298095703 y:5.309000015258789 z:24.209999084472656
      - residue HOH has 1 atoms
        - atom: O x: 0.3100000023841858 y:-5.184999942779541 z:48.196998596191406
      - residue HOH has 1 atoms
        - atom: O x: -13.279000282287598 y:3.0230000019073486 z:18.819000244140625
      - residue HOH has 1 atoms
        - atom: O x: -23.634000778198242 y:-16.91900062561035 z:58.840999603271484
      - residue HOH has 1 atoms
        - atom: O x: -2.9119999408721924 y:-6.1479997634887695 z:54.277000427246094
      - residue HOH has 1 atoms
        - atom: O x: -1.1610000133514404 y:10.043000221252441 z:47.38800048828125
      - residue HOH has 1 atoms
        - atom: O x: 29.593000411987305 y:-14.854999542236328 z:40.95399856567383
      - residue HOH has 1 atoms
        - atom: O x: -12.48900032043457 y:5.578999996185303 z:53.430999755859375
      - residue HOH has 1 atoms
        - atom: O x: 12.057000160217285 y:2.822999954223633 z:36.19300079345703
      - residue HOH has 1 atoms
        - atom: O x: 27.393999099731445 y:-13.095000267028809 z:37.10499954223633
      - residue HOH has 1 atoms
        - atom: O x: -28.520000457763672 y:9.92199993133545 z:38.66999816894531
      - residue HOH has 1 atoms
        - atom: O x: -5.872000217437744 y:10.038999557495117 z:19.493999481201172
      - residue HOH has 1 atoms
        - atom: O x: 25.288000106811523 y:-19.02199935913086 z:24.20199966430664
      - residue HOH has 1 atoms
        - atom: O x: -3.128999948501587 y:-4.6519999504089355 z:39.78499984741211
      - residue HOH has 1 atoms
        - atom: O x: -15.873000144958496 y:-9.145000457763672 z:20.726999282836914
      - residue HOH has 1 atoms
        - atom: O x: -5.986999988555908 y:-5.311999797821045 z:55.07600021362305
      - residue HOH has 1 atoms
        - atom: O x: -22.631999969482422 y:-11.35200023651123 z:32.91999816894531
      - residue HOH has 1 atoms
        - atom: O x: 15.930000305175781 y:-11.468000411987305 z:48.625
      - residue HOH has 1 atoms
        - atom: O x: 10.845999717712402 y:10.20199966430664 z:45.08700180053711
      - residue HOH has 1 atoms
        - atom: O x: -1.7580000162124634 y:-6.790999889373779 z:39.04999923706055
      - residue HOH has 1 atoms
        - atom: O x: 0.8429999947547913 y:1.375 z:59.32500076293945
      - residue HOH has 1 atoms
        - atom: O x: -23.67099952697754 y:9.42199993133545 z:51.630001068115234
      - residue HOH has 1 atoms
        - atom: O x: -7.863999843597412 y:-7.434000015258789 z:35.81700134277344
      - residue HOH has 1 atoms
        - atom: O x: -14.73900032043457 y:-2.5480000972747803 z:57.404998779296875
      - residue HOH has 1 atoms
        - atom: O x: -12.61299991607666 y:-3.4010000228881836 z:56.3650016784668
      - residue HOH has 1 atoms
        - atom: O x: -12.157999992370605 y:14.347999572753906 z:9.017999649047852
      - residue HOH has 1 atoms
        - atom: O x: -10.178999900817871 y:16.46299934387207 z:7.783999919891357
      - residue HOH has 1 atoms
        - atom: O x: -26.187999725341797 y:1.3630000352859497 z:32.53200149536133
      - residue HOH has 1 atoms
        - atom: O x: -19.97100067138672 y:13.097999572753906 z:46.61899948120117
      - residue HOH has 1 atoms
        - atom: O x: 24.52400016784668 y:-18.415000915527344 z:41.80699920654297
      - residue HOH has 1 atoms
        - atom: O x: -18.277999877929688 y:-7.002999782562256 z:31.499000549316406
      - residue HOH has 1 atoms
        - atom: O x: -17.966999053955078 y:-11.64799976348877 z:31.121000289916992
      - residue HOH has 1 atoms
        - atom: O x: 19.69499969482422 y:-9.303000450134277 z:57.77000045776367
      - residue HOH has 1 atoms
        - atom: O x: 20.47800064086914 y:-7.195000171661377 z:55.983001708984375
      - residue HOH has 1 atoms
        - atom: O x: -20.400999069213867 y:-4.622000217437744 z:26.72800064086914
      - residue HOH has 1 atoms
        - atom: O x: -23.23699951171875 y:-3.7679998874664307 z:26.531999588012695
      - residue HOH has 1 atoms
        - atom: O x: -21.20199966430664 y:0.3619999885559082 z:21.589000701904297
      - residue HOH has 1 atoms
        - atom: O x: -1.5870000123977661 y:-0.9639999866485596 z:42.207000732421875
      - residue HOH has 1 atoms
        - atom: O x: -24.679000854492188 y:-1.2269999980926514 z:32.99100112915039
      - residue HOH has 1 atoms
        - atom: O x: -27.02199935913086 y:10.708000183105469 z:33.94599914550781
      - residue HOH has 1 atoms
        - atom: O x: 11.821000099182129 y:-2.0350000858306885 z:62.28200149536133
      - residue HOH has 1 atoms
        - atom: O x: 13.04800033569336 y:-3.318000078201294 z:60.446998596191406
      - residue HOH has 1 atoms
        - atom: O x: -16.23699951171875 y:-0.24300000071525574 z:10.319000244140625
      - residue HOH has 1 atoms
        - atom: O x: -18.378000259399414 y:4.208000183105469 z:55.77299880981445
      - residue HOH has 1 atoms
        - atom: O x: -17.55299949645996 y:3.2249999046325684 z:51.25199890136719
      - residue HOH has 1 atoms
        - atom: O x: 9.491000175476074 y:-6.734000205993652 z:43.38999938964844
      - residue HOH has 1 atoms
        - atom: O x: 23.27199935913086 y:-28.881000518798828 z:39.137001037597656
      - residue HOH has 1 atoms
        - atom: O x: -13.192999839782715 y:17.964000701904297 z:19.21299934387207
      - residue HOH has 1 atoms
        - atom: O x: 21.905000686645508 y:-4.89900016784668 z:35.422000885009766
      - residue HOH has 1 atoms
        - atom: O x: 2.9800000190734863 y:-5.75 z:44.49599838256836
      - residue HOH has 1 atoms
        - atom: O x: 4.548999786376953 y:-9.392000198364258 z:42.6619987487793
      - residue HOH has 1 atoms
        - atom: O x: 4.017000198364258 y:-12.059000015258789 z:46.9379997253418
      - residue HOH has 1 atoms
        - atom: O x: 6.761000156402588 y:-12.234000205993652 z:47.72800064086914
      - residue HOH has 1 atoms
        - atom: O x: 5.676000118255615 y:-16.034000396728516 z:45.32099914550781
      - residue HOH has 1 atoms
        - atom: O x: -7.611999988555908 y:-15.508000373840332 z:46.83700180053711
      - residue HOH has 1 atoms
        - atom: O x: 10.524999618530273 y:-10.456999778747559 z:40.52899932861328
      - residue HOH has 1 atoms
        - atom: O x: 6.034999847412109 y:-0.2840000092983246 z:30.01300048828125
      - residue HOH has 1 atoms
        - atom: O x: 7.501999855041504 y:-17.215999603271484 z:20.152000427246094
      - residue HOH has 1 atoms
        - atom: O x: 7.015999794006348 y:-19.85099983215332 z:17.801000595092773
      - residue HOH has 1 atoms
        - atom: O x: 10.140999794006348 y:-20.489999771118164 z:16.503999710083008
      - residue HOH has 1 atoms
        - atom: O x: -28.062999725341797 y:-9.74899959564209 z:39.11600112915039
      - residue HOH has 1 atoms
        - atom: O x: -13.135000228881836 y:6.835000038146973 z:48.64500045776367
      - residue HOH has 1 atoms
        - atom: O x: -12.461000442504883 y:13.706000328063965 z:21.788999557495117
      - residue HOH has 1 atoms
        - atom: O x: -21.52199935913086 y:-11.213000297546387 z:47.9640007019043
      - residue HOH has 1 atoms
        - atom: O x: -22.802000045776367 y:-13.795999526977539 z:49.27899932861328
      - residue HOH has 1 atoms
        - atom: O x: 17.39699935913086 y:-18.308000564575195 z:38.902000427246094
      - residue HOH has 1 atoms
        - atom: O x: 13.23799991607666 y:-16.785999298095703 z:38.619998931884766
      - residue HOH has 1 atoms
        - atom: O x: 11.210000038146973 y:-8.220000267028809 z:18.395999908447266
      - residue HOH has 1 atoms
        - atom: O x: -1.9579999446868896 y:10.479000091552734 z:54.09700012207031
      - residue HOH has 1 atoms
        - atom: O x: 18.85700035095215 y:-12.720999717712402 z:17.263999938964844

Once we have the coordinates of an atom we can compute distances between atoms or angles. We can also align two structures rototranslating the two to minimize their distance. We will not cover this and many other features that are provided by Biopython, such as Pyhlogentic analysis tools, interface towards pathways in KEGG, clustering, etc. If you are interested, you can read about all the features available in the Biopython tutorial.

Exercises

  1. Write a python script that retrieves all the information present in SRA regarding PacBio sequencing performed on E.coli strain K12 (query term is “E.coli K12 wgs PacBio”). Print the number of results and for each id report the title, the accession id, the total number of spots and total number of bases sequenced.

Sample output:

Entries found: 11
Results for id: 9966072
WGS of E. coli K12 with PacBio HiFi
 - acc="SRR10971019"
 - total_spots="95514"
 - total_bases="1389500381"
Results for id: 6705337
PacBio RSII sequencing of E. coli K12
 - acc="SRR8154667"
 - total_spots="163482"
 - total_bases="1561717136"
Results for id: 6705336
PacBio RSII sequencing of E. coli K12
 - acc="SRR8154668"
 - total_spots="163482"
 - total_bases="897324802"
 ...
 ...

Show/Hide Solution

  1. Write a python function that reads all the entries of a blast alignment file in .xml format (like blast_res_apple.xml and outputs all the HSPs (see example below) having bitscore > B, alignment length > A and minimum percentage of identity > I, where B, A and I are input thresholds. Hint: implement a filtering function: filterHSPs(align, minBitscore = 0, minAlignLen = 0, minPercIdent = 0.1).

Alignments of MDC020656.85
    MDC020656.85: 1939-2593
    gi|125995253|dbj|AB270792.1|: 201263-201917
    Score:820.917 AlignLen:579 Id/Len:0.8812785388127854
    MDC020656.85: 1446-1935
    gi|125995253|dbj|AB270792.1|: 306490-306017
    Score:582.873 AlignLen:428 Id/Len:0.8629032258064516
    ....
    ....

that is reporting the HSP with query start-end position, subject start-end position, score, alignment length and number of identities / alignment length.

Show/Hide Solution

  1. Write a python function retrieve_sequences(search_term, number, outfile) that retrieves the first number of sequences from NCBI’s “nucleotide” database having a search term term (hint: use term and retmax parameters of Entrez.esearch) and stores them in a fasta file outfile (hint: use SeqIO.write). Test your code retrieving the first 5 entries having search term “starch AND Malus Domestica [Organism]”

Show/Hide Solution

  1. Write a python function that aligns the sequences in the file created in exercise 3. (here you can find mine) against the NCBI nr database limiting the hits to the Malus Domestica organism (parameter entrez_query=‘“Malus Domestica” [Organism]’ in qblast)and prints to screen the following info for each hsp:

    1. The title;

    2. Score and e-value;

    3. The number of alignments on the same subject, the number of identities and positives and the alignment length;

    4. The number of mismatches and the list of their positions (hint: you can use the match string and look for ” “).

Show/Hide Solution

  1. Write a python function getPublicationInfo(title_term,other_term) that retrieves the first 20 pubmed publications having the title_term in the title and other_term somewhere else in the text (hint use: “Title” and “[Other Term]” as esearch parameter term). For each publication print:

    1. the title

    2. authors

    3. journal

    4. year of publication (hint: get and split properly the “PubDate” entry)

    5. a link to the pubmed entry (hint: it is the string “https://www.ncbi.nlm.nih.gov/pubmed/” followed by the pubmed id (“eid” entry of the dictionary “ArticleIds”). es: https://www.ncbi.nlm.nih.gov/pubmed/26919684

Hint: to see how to combine search terms test them here: https://www.ncbi.nlm.nih.gov/pubmed/advanced.

Test your code calling getPublicationInfo("apple","drought")

Show/Hide Solution

  1. Write some python code to retrieve the structure of two forms of the aspartate transcarbamoylase (PDB ids: 4FYW and 1D09). If you are interested, read more about the Aspartate Transcarbamoylase here. Write a function that gets the .cif file name and prints:

    1. the number of chains, residues and atoms present in the file;

    2. a histogram of the residues (plotting it with matplotlib) that are not water (encoded as “HOH”);

    3. a link to an online tool to visualize the 3D structure. The link will be “http://www.rcsb.org/pdb/ngl/ngl.do?pdbid=” followed by the PDB id of the protein (e.g. 1d09).

Show/Hide Solution